(data stored in SCRATCH zone)

EMBL: CP001069.PE336

CP001069.PE336       Location/Qualifiers
FT   CDS             381972..382871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4111"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bur:Bcep18194_B2981 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4111"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29212"
FT                   /db_xref="GOA:B2UI11"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI11"
FT                   /protein_id="ACD29212.1"
FT                   /translation="MNAITPLALLESAPVSLRSSDGLGWDGFAATLLGIRAGAYRVPAM
FT                   AQHRVNVHVGPPVRMNCVCDGRRYSRIQAHGDADVIPAGVPGMWTDDADCRILRIAISD
FT                   TSVRSIAEQIGVRADITPRLQWRDARVRHLAAALGAELLAEDTSDALYAEGLCTALVVR
FT                   LLSSSRDGAAGVADRTGTLAPRVATRVIDYIEAHLHARLTLAELAAQAGLSVPHFNVLF
FT                   RATLGVPAHRYVVQRRVARAKALLLEGRRSASQIALDVGFAHQSHMTEWMQRLLGVTPR
FT                   DVIRAGKALAAAADPPAA"
     MNAITPLALL ESAPVSLRSS DGLGWDGFAA TLLGIRAGAY RVPAMAQHRV NVHVGPPVRM        60
     NCVCDGRRYS RIQAHGDADV IPAGVPGMWT DDADCRILRI AISDTSVRSI AEQIGVRADI       120
     TPRLQWRDAR VRHLAAALGA ELLAEDTSDA LYAEGLCTAL VVRLLSSSRD GAAGVADRTG       180
     TLAPRVATRV IDYIEAHLHA RLTLAELAAQ AGLSVPHFNV LFRATLGVPA HRYVVQRRVA       240
     RAKALLLEGR RSASQIALDV GFAHQSHMTE WMQRLLGVTP RDVIRAGKAL AAAADPPAA        299
//

If you have problems or comments...

PBIL Back to PBIL home page