(data stored in ACNUC7421 zone)

EMBL: CP001069.PE337

CP001069.PE337       Location/Qualifiers
FT   CDS             382967..383857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4112"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: bur:Bcep18194_B2980
FT                   NmrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4112"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29213"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI12"
FT                   /protein_id="ACD29213.1"
FT                   /translation="MFVIFGASGKVGHATAVALRNAGRPVRAVVRGARQGEALARIGCE
FT                   IAIADLTDPASVASAIKGATAVQMLCPVPVGDVDPAFTMERMIDVAADALRANPPSAVL
FT                   ALSDYGAELDRGTGLTRLFHLLEERLKPLATHLTLLRSAEHAQNWAAMLPVMLATGRLP
FT                   SLHYPLDRAFATVATQDVGALAAQLLLDGPSANTPRIVSVEGPRRVSLIDVARAFSAVV
FT                   GREIVADAVPRTAWSPMLQRAGLSANHVQLLTELYDAVNAGQIDVEKGVSEQRFGKTEL
FT                   HDVFASLLATHMSSS"
     MFVIFGASGK VGHATAVALR NAGRPVRAVV RGARQGEALA RIGCEIAIAD LTDPASVASA        60
     IKGATAVQML CPVPVGDVDP AFTMERMIDV AADALRANPP SAVLALSDYG AELDRGTGLT       120
     RLFHLLEERL KPLATHLTLL RSAEHAQNWA AMLPVMLATG RLPSLHYPLD RAFATVATQD       180
     VGALAAQLLL DGPSANTPRI VSVEGPRRVS LIDVARAFSA VVGREIVADA VPRTAWSPML       240
     QRAGLSANHV QLLTELYDAV NAGQIDVEKG VSEQRFGKTE LHDVFASLLA THMSSS           296
//

If you have problems or comments...

PBIL Back to PBIL home page