(data stored in ACNUC7421 zone)

EMBL: CP001069.PE340

CP001069.PE340       Location/Qualifiers
FT   CDS             complement(385400..385879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4115"
FT                   /product="PEBP family protein"
FT                   /note="PFAM: PEBP family protein; KEGG: rso:RS01998
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4115"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29216"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI15"
FT                   /protein_id="ACD29216.1"
FT                   /translation="MTLALTSPAFAAGGEIPSRLTCEGADTSPPLAWTGAPAGTRSLAL
FT                   IVDDPDAPDPAAPKMTWVHWVLYNIPPGTTSLAEDASRKGLPPGARPGNNDWQRTAYGG
FT                   PCPPIGRHRYYHKLYALNVELPELGAPTKAELERAMRGHVLAEAELVGTYQKHKP"
     MTLALTSPAF AAGGEIPSRL TCEGADTSPP LAWTGAPAGT RSLALIVDDP DAPDPAAPKM        60
     TWVHWVLYNI PPGTTSLAED ASRKGLPPGA RPGNNDWQRT AYGGPCPPIG RHRYYHKLYA       120
     LNVELPELGA PTKAELERAM RGHVLAEAEL VGTYQKHKP                              159
//

If you have problems or comments...

PBIL Back to PBIL home page