(data stored in ACNUC7421 zone)

EMBL: CP001069.PE344

CP001069.PE344       Location/Qualifiers
FT   CDS             complement(388079..389701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4119"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: rso:RS04763 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4119"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29220"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI19"
FT                   /protein_id="ACD29220.1"
FT                   /translation="MATRRSFLVGAAAAGVAAAGAASWAGFRAFTEITPSVRMPGQTAG
FT                   HQLRDLRVLPAPSETRRVGVAICGSGIGGLSCAWRLAKGGRRDVVVVEGPERYGNAAGG
FT                   AFGTQRFPTGAHYLPLPSMESTHVREMLADFGVIERDPFALRPTYDERVLVHAPDERLW
FT                   LGNRWQDGFVPHEGITEAERAEHTRFFAHIDRLRQTTGADGRRVFAVPTALSSADPAWR
FT                   ALDALTFRDWLHREGYRAATLHWYADYCCRDDYGATADQVSAWAGIAYFASRGGMASNA
FT                   EQGTVLTWPEGLDWMAKRLFEAAGLDEPGRLLQGSAARIGTTNEASARVFADVLQADGR
FT                   VVRLLADHVVSAMPLHVAKHIVDGFDVPAAELPETAPWLLANLLIDGFPPEHDDTPLAW
FT                   DNVVYRGTGLGYVVANHQDIRVGPPAQSVFTAYVALSDMTPKAAREWLLKASPQTLLDR
FT                   ALADLDTVYGIRLRTQIRRADLTLRGHAMAIPTPGFLSRPGIARLRESAGPIHYAHADL
FT                   SGYSVFEEAAWWGDRAARRILGN"
     MATRRSFLVG AAAAGVAAAG AASWAGFRAF TEITPSVRMP GQTAGHQLRD LRVLPAPSET        60
     RRVGVAICGS GIGGLSCAWR LAKGGRRDVV VVEGPERYGN AAGGAFGTQR FPTGAHYLPL       120
     PSMESTHVRE MLADFGVIER DPFALRPTYD ERVLVHAPDE RLWLGNRWQD GFVPHEGITE       180
     AERAEHTRFF AHIDRLRQTT GADGRRVFAV PTALSSADPA WRALDALTFR DWLHREGYRA       240
     ATLHWYADYC CRDDYGATAD QVSAWAGIAY FASRGGMASN AEQGTVLTWP EGLDWMAKRL       300
     FEAAGLDEPG RLLQGSAARI GTTNEASARV FADVLQADGR VVRLLADHVV SAMPLHVAKH       360
     IVDGFDVPAA ELPETAPWLL ANLLIDGFPP EHDDTPLAWD NVVYRGTGLG YVVANHQDIR       420
     VGPPAQSVFT AYVALSDMTP KAAREWLLKA SPQTLLDRAL ADLDTVYGIR LRTQIRRADL       480
     TLRGHAMAIP TPGFLSRPGI ARLRESAGPI HYAHADLSGY SVFEEAAWWG DRAARRILGN       540
//

If you have problems or comments...

PBIL Back to PBIL home page