(data stored in ACNUC7421 zone)

EMBL: CP001069.PE346

CP001069.PE346       Location/Qualifiers
FT   CDS             391456..391854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4121"
FT                   /product="protein of unknown function DUF350"
FT                   /note="PFAM: protein of unknown function DUF350; KEGG:
FT                   rso:RS05342 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4121"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29222"
FT                   /db_xref="GOA:B2UI21"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI21"
FT                   /protein_id="ACD29222.1"
FT                   /translation="MPDMTAPVIAYASHLLAGAVVFSGFFFVYLRLTPYDEFKLIREGN
FT                   IAAALSLSGALLGFVLTIASSITHADGLVPFLFWAVMASVVQLIVFLVLTRLMPDYRLQ
FT                   IEHNNIAAGMLFGVSALAVGVINAACLS"
     MPDMTAPVIA YASHLLAGAV VFSGFFFVYL RLTPYDEFKL IREGNIAAAL SLSGALLGFV        60
     LTIASSITHA DGLVPFLFWA VMASVVQLIV FLVLTRLMPD YRLQIEHNNI AAGMLFGVSA       120
     LAVGVINAAC LS                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page