(data stored in ACNUC7421 zone)

EMBL: CP001069.PE348

CP001069.PE348       Location/Qualifiers
FT   CDS             393041..394486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4123"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS05340 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4123"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29224"
FT                   /db_xref="GOA:B2UI23"
FT                   /db_xref="InterPro:IPR025235"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI23"
FT                   /protein_id="ACD29224.1"
FT                   /translation="MFHANCPACGAPVELKSAAAVMAVCSFCKSTLLRDGETLSDIGKM
FT                   SAVLEDYARVQIGTTGRYKNKAFTIVGRIQLRYDAGFWNEWYVLFDDGSDGWLAEASGQ
FT                   VTMTFARGTPANAVAFEGLRPGQLYDAEGKQFTLSDVREADCTGGQGELPFRVGEGWHA
FT                   RVADGRREDAFITLDYSDGTAPALYVGEATTLDVLECQLLRTDAEIKETAGRIPGKLTN
FT                   LDCPQCGTSIPFSPGVTGHVLCPGCGAAIDAATPRGDIIARARSVPQVATTLELGDKAL
FT                   IDGLQWQVIGVMRRAVVDGGGEWFEYLLYTPKRGFSWMVETDDGWFRANVLDRWPTRND
FT                   GRTAVLDGKVYARDEDYTSRVTYAAGAFNWRVQTGDQTRVVEYTAGGESLAAESDAHEL
FT                   TWSKSTPVSAAQIKAWFGKVVAEPAKASSNYMTVAVVACVLLGLLNLVPFFMAPGSVFG
FT                   ITFFAALLLLVPAWLVAKIGGGE"
     MFHANCPACG APVELKSAAA VMAVCSFCKS TLLRDGETLS DIGKMSAVLE DYARVQIGTT        60
     GRYKNKAFTI VGRIQLRYDA GFWNEWYVLF DDGSDGWLAE ASGQVTMTFA RGTPANAVAF       120
     EGLRPGQLYD AEGKQFTLSD VREADCTGGQ GELPFRVGEG WHARVADGRR EDAFITLDYS       180
     DGTAPALYVG EATTLDVLEC QLLRTDAEIK ETAGRIPGKL TNLDCPQCGT SIPFSPGVTG       240
     HVLCPGCGAA IDAATPRGDI IARARSVPQV ATTLELGDKA LIDGLQWQVI GVMRRAVVDG       300
     GGEWFEYLLY TPKRGFSWMV ETDDGWFRAN VLDRWPTRND GRTAVLDGKV YARDEDYTSR       360
     VTYAAGAFNW RVQTGDQTRV VEYTAGGESL AAESDAHELT WSKSTPVSAA QIKAWFGKVV       420
     AEPAKASSNY MTVAVVACVL LGLLNLVPFF MAPGSVFGIT FFAALLLLVP AWLVAKIGGG       480
     E                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page