(data stored in SCRATCH zone)

EMBL: CP001069.PE353

CP001069.PE353       Location/Qualifiers
FT   CDS             397763..399235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4128"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS05323 probable transporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4128"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29229"
FT                   /db_xref="GOA:B2UI28"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI28"
FT                   /protein_id="ACD29229.1"
FT                   /translation="MTAASHICRFCPRPMPTTPSASLDTSLKPLLWLVAMGLFMQTLDS
FT                   TIVNTALPAMARSLSESPLKMQSVIIAYTLTTAMLMPASGWLADRFGTRKMFFAAIFLF
FT                   TIGSLLCAESRSLTMLIASRVVQGVGGALLMPVGRLTVLRVVPREQFLPAMSFVTIPGL
FT                   IGPLIGPTLGGWLVEAVSWHWIFLINIPVGVIGALVTLKVMPDVHAEDDSRFDWSGYLM
FT                   LAFGMAAVSFSLDGLSELGFQHATVLVLLVFGLAALTAYWLHAGRVAGPLFPRTLFGIP
FT                   SFSIGVLGNLFARIGSGGMPFLIPLLLQVSLGYTPLQAGLMMVPVAAAGMAAKPLGTWA
FT                   IKRYGYRRMLSVNTVMVGLMMASFAVMTPNVPVWLRIVQLAIFGTFNSMQFTAMNTLTL
FT                   KDLTGPLASAGNSMLSMVMMLSMSLGVAAAGALLTGFTDFTAGPEGRDTLAAFHKTFVC
FT                   VGVMTCAAAWIFAQLSRFESTHVVKRPEMEVH"
     MTAASHICRF CPRPMPTTPS ASLDTSLKPL LWLVAMGLFM QTLDSTIVNT ALPAMARSLS        60
     ESPLKMQSVI IAYTLTTAML MPASGWLADR FGTRKMFFAA IFLFTIGSLL CAESRSLTML       120
     IASRVVQGVG GALLMPVGRL TVLRVVPREQ FLPAMSFVTI PGLIGPLIGP TLGGWLVEAV       180
     SWHWIFLINI PVGVIGALVT LKVMPDVHAE DDSRFDWSGY LMLAFGMAAV SFSLDGLSEL       240
     GFQHATVLVL LVFGLAALTA YWLHAGRVAG PLFPRTLFGI PSFSIGVLGN LFARIGSGGM       300
     PFLIPLLLQV SLGYTPLQAG LMMVPVAAAG MAAKPLGTWA IKRYGYRRML SVNTVMVGLM       360
     MASFAVMTPN VPVWLRIVQL AIFGTFNSMQ FTAMNTLTLK DLTGPLASAG NSMLSMVMML       420
     SMSLGVAAAG ALLTGFTDFT AGPEGRDTLA AFHKTFVCVG VMTCAAAWIF AQLSRFESTH       480
     VVKRPEMEVH                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page