(data stored in SCRATCH zone)

EMBL: CP001069.PE354

CP001069.PE354       Location/Qualifiers
FT   CDS             complement(399261..401411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4129"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: rso:RS05321 probable
FT                   ATP-dependent DNA helicase II protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4129"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29230"
FT                   /db_xref="GOA:B2UI29"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI29"
FT                   /protein_id="ACD29230.1"
FT                   /translation="MLAASPTPDTANAPATPGYLAQLNDQQRQAVEFGISGADAAETGP
FT                   LLVLAGAGSGKTHTLGWRVAHLVANGADPQRILLLTFSRRAASELSNRAGHLLARAMQG
FT                   ERSNNALNSAGTSYKTTLPWAGTFHGIGARLLREYAERVGLAPDFTIHDRSDSADLLNV
FT                   VRHELNLSTKERRFPLKQTCIAIYSRAINAESPLNAVLKHHFPWCAMWETQLRTLFDAY
FT                   VEAKQAQHVLDYDDLLLYWHAMVSDAELAAEIGARFDHILVDEYQDTNRLQSSILRALR
FT                   PDGRGVTVVGDDAQSIYAFRAATVRNILDFPRHFSRPAHTVLLERNYRSTQPILDASNG
FT                   VMRFATERFAKTLWTDRASTHRPRLISVRDEAEQARCVAEQVLHHREGGLTLKSQAVLF
FT                   RTASHSAPLEIELTRRNIPFVKYGGLKFLEAAHVKDVLSVLRWAENPRNRIAGFRVIQL
FT                   LPGAGPATAARVLDAMAEAADPIAALLAYEPPARLAGDWSTLMALMQTLRVPKDSLEWA
FT                   GELEAVGAWYSPHMERLHDDAAVRQGDLDQLARMAATYATRERFLTEMTLDPPELTSDE
FT                   SGDPYRDEDYLILSTIHSSKGQEWKAVYVLNAVDGCMPADLGAGSHEELEEERRLLYVA
FT                   MTRAREHLDILVPQRFYVTQQTPNGDRHIYASRTRFIPPALLPLFEACAWPEPEPGADP
FT                   AAEARAAAKVDLSKKMRGYWKK"
     MLAASPTPDT ANAPATPGYL AQLNDQQRQA VEFGISGADA AETGPLLVLA GAGSGKTHTL        60
     GWRVAHLVAN GADPQRILLL TFSRRAASEL SNRAGHLLAR AMQGERSNNA LNSAGTSYKT       120
     TLPWAGTFHG IGARLLREYA ERVGLAPDFT IHDRSDSADL LNVVRHELNL STKERRFPLK       180
     QTCIAIYSRA INAESPLNAV LKHHFPWCAM WETQLRTLFD AYVEAKQAQH VLDYDDLLLY       240
     WHAMVSDAEL AAEIGARFDH ILVDEYQDTN RLQSSILRAL RPDGRGVTVV GDDAQSIYAF       300
     RAATVRNILD FPRHFSRPAH TVLLERNYRS TQPILDASNG VMRFATERFA KTLWTDRAST       360
     HRPRLISVRD EAEQARCVAE QVLHHREGGL TLKSQAVLFR TASHSAPLEI ELTRRNIPFV       420
     KYGGLKFLEA AHVKDVLSVL RWAENPRNRI AGFRVIQLLP GAGPATAARV LDAMAEAADP       480
     IAALLAYEPP ARLAGDWSTL MALMQTLRVP KDSLEWAGEL EAVGAWYSPH MERLHDDAAV       540
     RQGDLDQLAR MAATYATRER FLTEMTLDPP ELTSDESGDP YRDEDYLILS TIHSSKGQEW       600
     KAVYVLNAVD GCMPADLGAG SHEELEEERR LLYVAMTRAR EHLDILVPQR FYVTQQTPNG       660
     DRHIYASRTR FIPPALLPLF EACAWPEPEP GADPAAEARA AAKVDLSKKM RGYWKK           716
//

If you have problems or comments...

PBIL Back to PBIL home page