(data stored in ACNUC7421 zone)

EMBL: CP001069.PE359

CP001069.PE359       Location/Qualifiers
FT   CDS             complement(404038..405219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS05318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4134"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29235"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI34"
FT                   /protein_id="ACD29235.1"
FT                   /translation="MDSDTDTGRFSFHRQDLANTLCDSLEGKGLADARSGLFLAAPRRT
FT                   GKSTFLREDLVPEVERRKWIAIYVDLWADRARDPGLLIADAIKSKLAQFDGPIAKLAKQ
FT                   AGMEKVDVLRTFTFNLGKIGLPPGITLADALDVLYKAVQRPVVLIIDEAQHALSTEAGT
FT                   NAMFALKAARDQMNQGVDEPRLFLVFTGSNRDKLANLLLNRTQPFFGSRVTNFPLLGRP
FT                   YVSAYTAWVNQHLAPDNQFKEDDMFAAFQLVGHRPEMLKGIVSEIALELGEAASLGELL
FT                   KRGAQGFRDRIWGEIESDYSALTEIQRAVLAVLIERGQGYSPFSEDSMKAYAAKLGHSE
FT                   FSTATVQAALDALRDKNLIWKESRGAYALEDESLALWFSETRGAHAVPPKLST"
     MDSDTDTGRF SFHRQDLANT LCDSLEGKGL ADARSGLFLA APRRTGKSTF LREDLVPEVE        60
     RRKWIAIYVD LWADRARDPG LLIADAIKSK LAQFDGPIAK LAKQAGMEKV DVLRTFTFNL       120
     GKIGLPPGIT LADALDVLYK AVQRPVVLII DEAQHALSTE AGTNAMFALK AARDQMNQGV       180
     DEPRLFLVFT GSNRDKLANL LLNRTQPFFG SRVTNFPLLG RPYVSAYTAW VNQHLAPDNQ       240
     FKEDDMFAAF QLVGHRPEML KGIVSEIALE LGEAASLGEL LKRGAQGFRD RIWGEIESDY       300
     SALTEIQRAV LAVLIERGQG YSPFSEDSMK AYAAKLGHSE FSTATVQAAL DALRDKNLIW       360
     KESRGAYALE DESLALWFSE TRGAHAVPPK LST                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page