(data stored in ACNUC7421 zone)

EMBL: CP001069.PE36

CP001069.PE36        Location/Qualifiers
FT   CDS             41560..42357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3796"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RS01988 probable amino-acid ATP-binding ABC
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3796"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28912"
FT                   /db_xref="GOA:B2UH61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH61"
FT                   /protein_id="ACD28912.1"
FT                   /translation="MLKLTSISKRFGGLSVLQDVNIEVPQGTIFGLIGPNGAGKTTVFN
FT                   LITGLLAPTGGSLTFNGENLVGKKPHQITQMGIARTFQNIRIFKEMTLLENVVVGMHRH
FT                   LDYGAPGLLLSLPKYRAAERRARDRALELLSWVKLDHKAHDIADNLSYGDQRKLELARA
FT                   LATEPKLLLLDEPVAGMNTGEKVDLMAEIENIKARGYTIFMIEHDMRFVMGLCERIAVL
FT                   NFGRIIAEGPPEAIRNNPQVIEAYLGRDDDEADGSAAAEKETA"
     MLKLTSISKR FGGLSVLQDV NIEVPQGTIF GLIGPNGAGK TTVFNLITGL LAPTGGSLTF        60
     NGENLVGKKP HQITQMGIAR TFQNIRIFKE MTLLENVVVG MHRHLDYGAP GLLLSLPKYR       120
     AAERRARDRA LELLSWVKLD HKAHDIADNL SYGDQRKLEL ARALATEPKL LLLDEPVAGM       180
     NTGEKVDLMA EIENIKARGY TIFMIEHDMR FVMGLCERIA VLNFGRIIAE GPPEAIRNNP       240
     QVIEAYLGRD DDEADGSAAA EKETA                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page