(data stored in SCRATCH zone)

EMBL: CP001069.PE360

CP001069.PE360       Location/Qualifiers
FT   CDS             405407..405808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4135"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS05317 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4135"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29236"
FT                   /db_xref="GOA:B2UI35"
FT                   /db_xref="InterPro:IPR021333"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI35"
FT                   /protein_id="ACD29236.1"
FT                   /translation="MLHRRWLFLVWLAIVLNVLSPVLASARAAATGTLDVELCSATAPH
FT                   GSTVQVAIDLQGDGSADDSTAHHGVAHCLYCPGFAAGLALASVPALDVPSAHFVYRVRQ
FT                   PATPAPVYARSALRVAGSRAPPVSPSLSI"
     MLHRRWLFLV WLAIVLNVLS PVLASARAAA TGTLDVELCS ATAPHGSTVQ VAIDLQGDGS        60
     ADDSTAHHGV AHCLYCPGFA AGLALASVPA LDVPSAHFVY RVRQPATPAP VYARSALRVA       120
     GSRAPPVSPS LSI                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page