(data stored in ACNUC7421 zone)

EMBL: CP001069.PE361

CP001069.PE361       Location/Qualifiers
FT   CDS             405891..408209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4136"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: rso:RS05316 putative ferrisiderophore
FT                   receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4136"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29237"
FT                   /db_xref="GOA:B2UI36"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI36"
FT                   /protein_id="ACD29237.1"
FT                   /translation="MSFHKRAGAAALKRTLVCRAALALSAAAPLSAFAAEDAASVPAPV
FT                   TQELAPTVVRANANPAPFARNTPAVVQSVTADQLADRNVVTAEDAVKYQPNVMVRRRFI
FT                   GDRNSIFAGRDFNEIQSARGLLYADGILLSNLLGSSYSYPPRWSMVGPDELARVDILYG
FT                   PFSALLPGNSMGTTIAMTLRRPEKFEAAAQTQIMSQHYNDAYGFSRNVTGNHESASLGD
FT                   RIGKFWYALSVDRLENDSQPMQYATPNSRFTAGGTPVPVTGARQDLGPNGQPRVILGPQ
FT                   MLERTQQLQETLRFGYVFSDSLEASLTLGHWENHFNDQALSFLRDAAGNTVTGGNVLIN
FT                   GTPYTIAPNTFAPQNGDQENWLYGLGVKGKIGGWKIDTNASAYNVSRDILRASNTAAGN
FT                   GPGTVFYGDGTGWSNFDIKATSPTVSGHTFTTGYHYDQYHLRNQTFNASNWSTETLSTL
FT                   KSSYQGDTQTQAVFLQDAWAFAPRWLATLGLRYESWRAYNGQLGNGTSALGYASRTEDA
FT                   FSPKAAIQWQATQDTLLRLSYGCAVRFPTVAELFQGTISGNTIVNNDPNLKPERANDFD
FT                   FTVEQAVPYGVLRTSLFQSDVRDSIYTQTNITVTPNVTNVQNVDRVRTRGIELAYSGQE
FT                   VLQDAGVRGVDVEANVAFTQSKTLADAANPTYVDKTWPRMPRVRANLFASWHATPDWTV
FT                   GAGVRYSGRQYGTLDNTDVLPNVYGGTSSFFTVDLKASYRIDKHITLALGVDNLTDRRY
FT                   FVYHPYPSRTFYGQLKWRL"
     MSFHKRAGAA ALKRTLVCRA ALALSAAAPL SAFAAEDAAS VPAPVTQELA PTVVRANANP        60
     APFARNTPAV VQSVTADQLA DRNVVTAEDA VKYQPNVMVR RRFIGDRNSI FAGRDFNEIQ       120
     SARGLLYADG ILLSNLLGSS YSYPPRWSMV GPDELARVDI LYGPFSALLP GNSMGTTIAM       180
     TLRRPEKFEA AAQTQIMSQH YNDAYGFSRN VTGNHESASL GDRIGKFWYA LSVDRLENDS       240
     QPMQYATPNS RFTAGGTPVP VTGARQDLGP NGQPRVILGP QMLERTQQLQ ETLRFGYVFS       300
     DSLEASLTLG HWENHFNDQA LSFLRDAAGN TVTGGNVLIN GTPYTIAPNT FAPQNGDQEN       360
     WLYGLGVKGK IGGWKIDTNA SAYNVSRDIL RASNTAAGNG PGTVFYGDGT GWSNFDIKAT       420
     SPTVSGHTFT TGYHYDQYHL RNQTFNASNW STETLSTLKS SYQGDTQTQA VFLQDAWAFA       480
     PRWLATLGLR YESWRAYNGQ LGNGTSALGY ASRTEDAFSP KAAIQWQATQ DTLLRLSYGC       540
     AVRFPTVAEL FQGTISGNTI VNNDPNLKPE RANDFDFTVE QAVPYGVLRT SLFQSDVRDS       600
     IYTQTNITVT PNVTNVQNVD RVRTRGIELA YSGQEVLQDA GVRGVDVEAN VAFTQSKTLA       660
     DAANPTYVDK TWPRMPRVRA NLFASWHATP DWTVGAGVRY SGRQYGTLDN TDVLPNVYGG       720
     TSSFFTVDLK ASYRIDKHIT LALGVDNLTD RRYFVYHPYP SRTFYGQLKW RL               772
//

If you have problems or comments...

PBIL Back to PBIL home page