(data stored in SCRATCH zone)

EMBL: CP001069.PE362

CP001069.PE362       Location/Qualifiers
FT   CDS             408197..409462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4137"
FT                   /product="glycosyl hydrolase BNR repeat-containing protein"
FT                   /note="PFAM: glycosyl hydrolase BNR repeat-containing
FT                   protein; KEGG: rso:RS05315 putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4137"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29238"
FT                   /db_xref="GOA:B2UI37"
FT                   /db_xref="InterPro:IPR026856"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI37"
FT                   /protein_id="ACD29238.1"
FT                   /translation="MASVMQSIPRFVAGALLTLAATVAPAHEGHDHGAMAAKPAAKPQL
FT                   ATTAAFDKAGRLWVTWAEGQHVVVASSGDLGKTLSAPQRVNPQPEPIYTDGENRPKVIA
FT                   SPDGALYVSWSRPLDAPYTGFVRFSRSLDGGRTWSAPVTVHHDRQPITHRFDSIAVDGA
FT                   GRIFVTWIDKRDLLLAQAAKQPYAGAAVYYTVSTDRGATFAPERKVIDQTCECCRIALA
FT                   PDADGHMLALWRNVFAGQIRDHALATLPIGNTPLAITRATFSEWRVDACPHHGPALAVT
FT                   ADGVRHMAWFSVLQDKPGLFYSRLSADGKPIGGAWAFGGSAQAGAQASHPAMLAADGAL
FT                   WLAWKQFADDRMQILLRRSTDGGAHWTAPASAANTDSGSDHPQLLARDGHVYLSWRTQA
FT                   EGYRLIDISNVSPSNPSLEASK"
     MASVMQSIPR FVAGALLTLA ATVAPAHEGH DHGAMAAKPA AKPQLATTAA FDKAGRLWVT        60
     WAEGQHVVVA SSGDLGKTLS APQRVNPQPE PIYTDGENRP KVIASPDGAL YVSWSRPLDA       120
     PYTGFVRFSR SLDGGRTWSA PVTVHHDRQP ITHRFDSIAV DGAGRIFVTW IDKRDLLLAQ       180
     AAKQPYAGAA VYYTVSTDRG ATFAPERKVI DQTCECCRIA LAPDADGHML ALWRNVFAGQ       240
     IRDHALATLP IGNTPLAITR ATFSEWRVDA CPHHGPALAV TADGVRHMAW FSVLQDKPGL       300
     FYSRLSADGK PIGGAWAFGG SAQAGAQASH PAMLAADGAL WLAWKQFADD RMQILLRRST       360
     DGGAHWTAPA SAANTDSGSD HPQLLARDGH VYLSWRTQAE GYRLIDISNV SPSNPSLEAS       420
     K                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page