(data stored in ACNUC7421 zone)

EMBL: CP001069.PE364

CP001069.PE364       Location/Qualifiers
FT   CDS             complement(410199..410477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4139"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29240"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI39"
FT                   /protein_id="ACD29240.1"
FT                   /translation="MSHMQPHPTRRPPAPRAYRYPLSHRATLSAWHAHITETPSAEPEI
FT                   AGAQAVFYIARSVAVLLAAVAVGLGAASNDAERPSTAYPSSSQATTR"
     MSHMQPHPTR RPPAPRAYRY PLSHRATLSA WHAHITETPS AEPEIAGAQA VFYIARSVAV        60
     LLAAVAVGLG AASNDAERPS TAYPSSSQAT TR                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page