(data stored in ACNUC7421 zone)

EMBL: CP001069.PE365

CP001069.PE365       Location/Qualifiers
FT   CDS             complement(410495..411253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4140"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   rso:RS05313 probable integral membrane transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4140"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29241"
FT                   /db_xref="GOA:B2UI40"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI40"
FT                   /protein_id="ACD29241.1"
FT                   /translation="MESATLLLFGAGLLAGMMNALAGGGSFVTLPALMFAGVPSVFANA
FT                   SSTVALLPGAATSAWAYRADYRGFGHVSMRAMVGISLVGGLFGALLLMNTSSRAFDFIV
FT                   PWLLLVGSLAFTFGKQVGVWLRQRVQIGRTTLLVAQGALAIYGGYFGGAVGIMMMAVWA
FT                   LFGHDDIKALNASRTLLVGATNLVAVACFALANMVWWPQTLVMLVAAALGGHLGAHVGK
FT                   RLPVPVVRALISTFGFSMTALLFWRAWSHA"
     MESATLLLFG AGLLAGMMNA LAGGGSFVTL PALMFAGVPS VFANASSTVA LLPGAATSAW        60
     AYRADYRGFG HVSMRAMVGI SLVGGLFGAL LLMNTSSRAF DFIVPWLLLV GSLAFTFGKQ       120
     VGVWLRQRVQ IGRTTLLVAQ GALAIYGGYF GGAVGIMMMA VWALFGHDDI KALNASRTLL       180
     VGATNLVAVA CFALANMVWW PQTLVMLVAA ALGGHLGAHV GKRLPVPVVR ALISTFGFSM       240
     TALLFWRAWS HA                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page