(data stored in SCRATCH zone)

EMBL: CP001069.PE366

CP001069.PE366       Location/Qualifiers
FT   CDS             411384..412268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4141"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RS05312 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4141"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29242"
FT                   /db_xref="GOA:B2UI41"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI41"
FT                   /protein_id="ACD29242.1"
FT                   /translation="MRFDLTDLRLFLHTAEAGSITAGAERAHLTLASASARIRGMEDAL
FT                   GAPLLTRNRRGVETTAAGRTLVHHARVVLQQMDRMRGELGEYARGLKGYVRLLSNTAAM
FT                   TEFLPETLSAFLAAHPEVDVDLEELVSHEIVEAIAQGRADIGIVNDAVDLSGLETFPFR
FT                   HDRLVLVTAREHPLAERRELAFVETLQEDFVGLTGDNALQAYLAGHAARAGHRLKYRVR
FT                   LRSFDAVCRMVERNVGVGVIPEHAAIRLQRSMGIRRVRLTDAWATRLLRICVRHFDDLP
FT                   VFARQLIEHLREA"
     MRFDLTDLRL FLHTAEAGSI TAGAERAHLT LASASARIRG MEDALGAPLL TRNRRGVETT        60
     AAGRTLVHHA RVVLQQMDRM RGELGEYARG LKGYVRLLSN TAAMTEFLPE TLSAFLAAHP       120
     EVDVDLEELV SHEIVEAIAQ GRADIGIVND AVDLSGLETF PFRHDRLVLV TAREHPLAER       180
     RELAFVETLQ EDFVGLTGDN ALQAYLAGHA ARAGHRLKYR VRLRSFDAVC RMVERNVGVG       240
     VIPEHAAIRL QRSMGIRRVR LTDAWATRLL RICVRHFDDL PVFARQLIEH LREA             294
//

If you have problems or comments...

PBIL Back to PBIL home page