(data stored in ACNUC7421 zone)

EMBL: CP001069.PE370

CP001069.PE370       Location/Qualifiers
FT   CDS             complement(415470..415670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4145"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29246"
FT                   /db_xref="GOA:B2UI45"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI45"
FT                   /protein_id="ACD29246.1"
FT                   /translation="MGTIKRETAGLTARLGWERHPANWQMIPTRRRLFQTRLPATRAST
FT                   ILLWLLAISITVGVGLLHRLW"
     MGTIKRETAG LTARLGWERH PANWQMIPTR RRLFQTRLPA TRASTILLWL LAISITVGVG        60
     LLHRLW                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page