(data stored in ACNUC7421 zone)

EMBL: CP001069.PE371

CP001069.PE371       Location/Qualifiers
FT   CDS             416089..417147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4146"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RS05306 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4146"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29247"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI46"
FT                   /protein_id="ACD29247.1"
FT                   /translation="MTQARRARSNRAFAEFGQGGRAVLVAWAALVAGAAAHAAAPSLAA
FT                   RRAAVQSTLAHAGSCQRLGDYYWEIGDAHGELIHGQQGQRIGANKTVRLASASKWIFGA
FT                   YVVERAQGKPTPAEIDALTMRSGYDGLNPLLCNRNDTVQSCFARGRNATFTPGHVGRFS
FT                   YNGGHDQKLLIDLGLGRADAEALNNDLDHQLANAPGLRDAGKPLGIRYLAPEPGGGMIA
FT                   TPAAYGQFLRRLIRGEYQLGRMLGQHAVCTEPGTCPTAVSTPAALPWHYALNYWIEDQP
FT                   GGDGAFSSAGAFGFYPWITADKRYYGMLVRETLGPRAYVRSAACGALIRRAFAEGKPQH
FT                   SAEGAGSADFAD"
     MTQARRARSN RAFAEFGQGG RAVLVAWAAL VAGAAAHAAA PSLAARRAAV QSTLAHAGSC        60
     QRLGDYYWEI GDAHGELIHG QQGQRIGANK TVRLASASKW IFGAYVVERA QGKPTPAEID       120
     ALTMRSGYDG LNPLLCNRND TVQSCFARGR NATFTPGHVG RFSYNGGHDQ KLLIDLGLGR       180
     ADAEALNNDL DHQLANAPGL RDAGKPLGIR YLAPEPGGGM IATPAAYGQF LRRLIRGEYQ       240
     LGRMLGQHAV CTEPGTCPTA VSTPAALPWH YALNYWIEDQ PGGDGAFSSA GAFGFYPWIT       300
     ADKRYYGMLV RETLGPRAYV RSAACGALIR RAFAEGKPQH SAEGAGSADF AD               352
//

If you have problems or comments...

PBIL Back to PBIL home page