(data stored in SCRATCH zone)

EMBL: CP001069.PE377

CP001069.PE377       Location/Qualifiers
FT   CDS             421438..423018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4154"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS05301 probable integral membrane transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4154"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29253"
FT                   /db_xref="GOA:B2UI52"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI52"
FT                   /protein_id="ACD29253.1"
FT                   /translation="MSSRPSIEPPKPDTPTAPIASASSPLDALPVPEIPVMAVMGGLML
FT                   AILLGALEQTIVAVALPVIAGEFNGFALMAWLVSAYLVASTVVTPIYGKLSDLYGRRAM
FT                   LTTAIVLFVLASVACAVATSMPMLLFARVLQGLGGGGLISVSQATIADVVPLRERGRYQ
FT                   GYVSGMWAMASLAGPVIGGYLTHYLSWRWIFWINLPLGIVALFVVRRTLRHLPVAHQRR
FT                   PIDVPGVVLFAGGLTALLLMITRVGQGTPLTQPENLGLLAAAVVLLGAFVWQENRAVEP
FT                   IIPLSMFRVRTVTICCLALFLCFFQLIATSVLMPLRFQMVAGASPDAAALRLVPLTLSI
FT                   PLGAFIAGKWMTHSGRYKPLMLGGACVVPFAVASLGLLDPHSVLALTLAMIVLGLSIGV
FT                   QFPTGLVATQNAVSPQTVGLATALTAFSRLLGGAVGVAVLTSVLIALLRQAAPEAQVAA
FT                   GGDVLMDLFHAALASSGADAQALQRAGESAFRHLFFFAAAVSVISPLLVMRLEEKALRG
FT                   KVSLAEAVE"
     MSSRPSIEPP KPDTPTAPIA SASSPLDALP VPEIPVMAVM GGLMLAILLG ALEQTIVAVA        60
     LPVIAGEFNG FALMAWLVSA YLVASTVVTP IYGKLSDLYG RRAMLTTAIV LFVLASVACA       120
     VATSMPMLLF ARVLQGLGGG GLISVSQATI ADVVPLRERG RYQGYVSGMW AMASLAGPVI       180
     GGYLTHYLSW RWIFWINLPL GIVALFVVRR TLRHLPVAHQ RRPIDVPGVV LFAGGLTALL       240
     LMITRVGQGT PLTQPENLGL LAAAVVLLGA FVWQENRAVE PIIPLSMFRV RTVTICCLAL       300
     FLCFFQLIAT SVLMPLRFQM VAGASPDAAA LRLVPLTLSI PLGAFIAGKW MTHSGRYKPL       360
     MLGGACVVPF AVASLGLLDP HSVLALTLAM IVLGLSIGVQ FPTGLVATQN AVSPQTVGLA       420
     TALTAFSRLL GGAVGVAVLT SVLIALLRQA APEAQVAAGG DVLMDLFHAA LASSGADAQA       480
     LQRAGESAFR HLFFFAAAVS VISPLLVMRL EEKALRGKVS LAEAVE                      526
//

If you have problems or comments...

PBIL Back to PBIL home page