(data stored in ACNUC7421 zone)

EMBL: CP001069.PE38

CP001069.PE38        Location/Qualifiers
FT   CDS             complement(43153..44049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3798"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RS01990 probable
FT                   transcriptional regulator transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3798"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28914"
FT                   /db_xref="GOA:B2UH63"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH63"
FT                   /protein_id="ACD28914.1"
FT                   /translation="MTADPSTSLQWDDVRYFLVLAREGSLSAAARRLGVEHTTVARRAD
FT                   ALEQSLGVRLFDRLPRGWRLTAEGSALAERAERMEQEAASFARAAAGAGSLRGTVRISA
FT                   PPTVASHVIAPNLTLLRKQWPGIDLVLLGEKRNANLMAHEADLAVRLSRPTASTLAARP
FT                   LGSLGYGLYATPEVLAQPEAQWQFIGYDERLRHVPQQRWLDDYAGARRVVLRCSDLSAM
FT                   HQAALAGVGVAALPHLLGAPAETGTLLRRVPVDDPALHREIWLAIHPDVRRSPRVRAVA
FT                   DALIALFDAQRHVLAGH"
     MTADPSTSLQ WDDVRYFLVL AREGSLSAAA RRLGVEHTTV ARRADALEQS LGVRLFDRLP        60
     RGWRLTAEGS ALAERAERME QEAASFARAA AGAGSLRGTV RISAPPTVAS HVIAPNLTLL       120
     RKQWPGIDLV LLGEKRNANL MAHEADLAVR LSRPTASTLA ARPLGSLGYG LYATPEVLAQ       180
     PEAQWQFIGY DERLRHVPQQ RWLDDYAGAR RVVLRCSDLS AMHQAALAGV GVAALPHLLG       240
     APAETGTLLR RVPVDDPALH REIWLAIHPD VRRSPRVRAV ADALIALFDA QRHVLAGH         298
//

If you have problems or comments...

PBIL Back to PBIL home page