(data stored in ACNUC7421 zone)

EMBL: CP001069.PE381

CP001069.PE381       Location/Qualifiers
FT   CDS             complement(425737..426768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4158"
FT                   /product="cytochrome bd ubiquinol oxidase subunit II"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit II;
FT                   KEGG: rso:RS03187 putative transmembrane cytochrome BD-II
FT                   oxidase (subunit II) oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4158"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29257"
FT                   /db_xref="GOA:B2UI56"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI56"
FT                   /protein_id="ACD29257.1"
FT                   /translation="MSTIPDLTQPAGWLPVVFMALMGIAVLAYVVLDGYDLGVGILLRR
FT                   ADDAEKDTMIASIGPFWDANETWLVLGVGLLLVAFPAAHGEILGALYLPVALMLFGLIL
FT                   RGVAFDFRVKARAHHKPWWNRAFYAGSVIATAAQGLMLGLYITGFQYDAANVIFAICTA
FT                   GGLIAGYLLLGATWLIMKTEGALQLRAVLWARGSLWFTALGVAAVSLATPWVSTRVFDK
FT                   WFALPNIILLAPVPLVTIVLFLLIDWVLRRLPQQIAKGDEHLVWAPFVGTGAIFLLAFN
FT                   GLAYSLFPYLVVDRLDIWQAASAPESLEFMLVGVAIVLPTIVGYTIYSYKVFHGKATEL
FT                   RYY"
     MSTIPDLTQP AGWLPVVFMA LMGIAVLAYV VLDGYDLGVG ILLRRADDAE KDTMIASIGP        60
     FWDANETWLV LGVGLLLVAF PAAHGEILGA LYLPVALMLF GLILRGVAFD FRVKARAHHK       120
     PWWNRAFYAG SVIATAAQGL MLGLYITGFQ YDAANVIFAI CTAGGLIAGY LLLGATWLIM       180
     KTEGALQLRA VLWARGSLWF TALGVAAVSL ATPWVSTRVF DKWFALPNII LLAPVPLVTI       240
     VLFLLIDWVL RRLPQQIAKG DEHLVWAPFV GTGAIFLLAF NGLAYSLFPY LVVDRLDIWQ       300
     AASAPESLEF MLVGVAIVLP TIVGYTIYSY KVFHGKATEL RYY                         343
//

If you have problems or comments...

PBIL Back to PBIL home page