(data stored in SCRATCH zone)

EMBL: CP001069.PE383

CP001069.PE383       Location/Qualifiers
FT   CDS             complement(428154..428714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4160"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS03185 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4160"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29259"
FT                   /db_xref="GOA:B2UI58"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI58"
FT                   /protein_id="ACD29259.1"
FT                   /translation="MQLSPLKQRFVLHFGEMGSRWGINRTVGQIYALLYAAREPINADE
FT                   IAESLGFSRSNVSIGLKELESWKLVRLSHKPGDRREYFSAPDDIWTIFRTLAEERRKRE
FT                   IDPTLSLLRDVMLESPTDPDDRHAQARMKQMYELITLMTNWFDDVQKLDAESLQQLMKM
FT                   GAKVHKLLEMKNKLAVVVGGKSK"
     MQLSPLKQRF VLHFGEMGSR WGINRTVGQI YALLYAAREP INADEIAESL GFSRSNVSIG        60
     LKELESWKLV RLSHKPGDRR EYFSAPDDIW TIFRTLAEER RKREIDPTLS LLRDVMLESP       120
     TDPDDRHAQA RMKQMYELIT LMTNWFDDVQ KLDAESLQQL MKMGAKVHKL LEMKNKLAVV       180
     VGGKSK                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page