(data stored in ACNUC7421 zone)

EMBL: CP001069.PE385

CP001069.PE385       Location/Qualifiers
FT   CDS             429339..429632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc2198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4162"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29261"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI60"
FT                   /protein_id="ACD29261.1"
FT                   /translation="MSDQLTTAPQELYEGFEIHVVPSPTRANSLRYTYTGYVCHPGADP
FT                   QLPGHVVPFHADGDDTFRSPEEAMEEAVHVARSIVDGTHPDLSVLSIVTHGY"
     MSDQLTTAPQ ELYEGFEIHV VPSPTRANSL RYTYTGYVCH PGADPQLPGH VVPFHADGDD        60
     TFRSPEEAME EAVHVARSIV DGTHPDLSVL SIVTHGY                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page