(data stored in SCRATCH zone)

EMBL: CP001069.PE386

CP001069.PE386       Location/Qualifiers
FT   CDS             430017..431339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4163"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS03167 probable high affinity nitrate transporter
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4163"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29262"
FT                   /db_xref="GOA:B2UI61"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI61"
FT                   /protein_id="ACD29262.1"
FT                   /translation="MTGKATRIDLFSLRTPQMRAFHLTWLAFFVCFYAWFACAPLMPVL
FT                   KGEFHLTPGQIANINIAAVAVTILVRLIVGPLCDRFGPRKTYTGLLLLGAIPVLGVALA
FT                   QSYETFLFFRLAIGAIGASFVITQYHTSVMFAPNVVGTANAAAAGWGNAGGGVAQGTMP
FT                   LLLTAIVMMGVTQSMGWRLAMVVPGVAMLLVAALYWRYTQDCPEGNFSALRAAGKTIEG
FT                   GKKGGWGSFVAAAGNYRVWLLFITYGACFGVEIFIHNIAATYYVDHFGLSLSAAGMAAA
FT                   SFGLLALFARALGGIVSDRVAAKRGLDARTQLLCVLMMGEGLGLFGFAHAGSVPVAILA
FT                   MLGFGLFTHMACGATYALVPFIDRRALGGVAGIIGAGGNAGAVAAGFLLKGMADTQATL
FT                   SILGVLVALSAICAIAVRFSAEHKAREQALYDNTLAAAGNA"
     MTGKATRIDL FSLRTPQMRA FHLTWLAFFV CFYAWFACAP LMPVLKGEFH LTPGQIANIN        60
     IAAVAVTILV RLIVGPLCDR FGPRKTYTGL LLLGAIPVLG VALAQSYETF LFFRLAIGAI       120
     GASFVITQYH TSVMFAPNVV GTANAAAAGW GNAGGGVAQG TMPLLLTAIV MMGVTQSMGW       180
     RLAMVVPGVA MLLVAALYWR YTQDCPEGNF SALRAAGKTI EGGKKGGWGS FVAAAGNYRV       240
     WLLFITYGAC FGVEIFIHNI AATYYVDHFG LSLSAAGMAA ASFGLLALFA RALGGIVSDR       300
     VAAKRGLDAR TQLLCVLMMG EGLGLFGFAH AGSVPVAILA MLGFGLFTHM ACGATYALVP       360
     FIDRRALGGV AGIIGAGGNA GAVAAGFLLK GMADTQATLS ILGVLVALSA ICAIAVRFSA       420
     EHKAREQALY DNTLAAAGNA                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page