(data stored in ACNUC7421 zone)

EMBL: CP001069.PE391

CP001069.PE391       Location/Qualifiers
FT   CDS             438704..439318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS03158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4168"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29267"
FT                   /db_xref="InterPro:IPR018715"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI66"
FT                   /protein_id="ACD29267.1"
FT                   /translation="MVAAAIHACTAFAGTRRLAAGPVRDVARVVKIHVDAHPESQVLVF
FT                   DHTTAQPVEFDLRGTVGDVLARLDSTAPSATQPAESESRPRGPGRPKLGVIAREVTLLP
FT                   RHWDWLAAQPGGASVTLRKLVEDARRAAEGADRRRVAQEAAYRFMSAMAGDAAGFEEAT
FT                   RALFAADAVAFESLTHSWPADVRDFARELASRAFNPQQEAA"
     MVAAAIHACT AFAGTRRLAA GPVRDVARVV KIHVDAHPES QVLVFDHTTA QPVEFDLRGT        60
     VGDVLARLDS TAPSATQPAE SESRPRGPGR PKLGVIAREV TLLPRHWDWL AAQPGGASVT       120
     LRKLVEDARR AAEGADRRRV AQEAAYRFMS AMAGDAAGFE EATRALFAAD AVAFESLTHS       180
     WPADVRDFAR ELASRAFNPQ QEAA                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page