(data stored in ACNUC7421 zone)

EMBL: CP001069.PE392

CP001069.PE392       Location/Qualifiers
FT   CDS             439315..440682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4169"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: rso:RS03157
FT                   probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4169"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29268"
FT                   /db_xref="GOA:B2UI67"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI67"
FT                   /protein_id="ACD29268.1"
FT                   /translation="MTAPAARPLWRTFIAFLGPLILANILQSLSGTLNNVYVGHMLGVK
FT                   ALAAVSAFFPILFFFIAFIIGLGSGAAVLIGQAWGAKKPEAVKTVAGTTLSVGFIVGLA
FT                   VALLGGPFANALLGWLGTPADILQDATLYASVMLYAMPGLFVYLLATAMMRGVGDTRTP
FT                   LRTLALSTSIGLVLTPTFIRGWFGLPQLGVASGAAATIISFTIALVWLAFFLRRRNHPL
FT                   APDAVLARHLWVDFGVLKTVLKIGVPTGLQLVVISIAELALLSFVNGFGSDATAAYGAG
FT                   TQIISYVQFPAMSIAITASILGAQAIGSGNTERLDAITRTGLWLNVAITGVLVLMALLF
FT                   SRAVIGWFTTSAEVMSLAQSLLHISLWSSVIFGMASVFSGVMRSSGTVMAPTAISILAI
FT                   AAVEVPVAWVLSRHIGTDGIWAAYPAAFLAMFVMQGLYYALVWRRRAQRFGIRRMV"
     MTAPAARPLW RTFIAFLGPL ILANILQSLS GTLNNVYVGH MLGVKALAAV SAFFPILFFF        60
     IAFIIGLGSG AAVLIGQAWG AKKPEAVKTV AGTTLSVGFI VGLAVALLGG PFANALLGWL       120
     GTPADILQDA TLYASVMLYA MPGLFVYLLA TAMMRGVGDT RTPLRTLALS TSIGLVLTPT       180
     FIRGWFGLPQ LGVASGAAAT IISFTIALVW LAFFLRRRNH PLAPDAVLAR HLWVDFGVLK       240
     TVLKIGVPTG LQLVVISIAE LALLSFVNGF GSDATAAYGA GTQIISYVQF PAMSIAITAS       300
     ILGAQAIGSG NTERLDAITR TGLWLNVAIT GVLVLMALLF SRAVIGWFTT SAEVMSLAQS       360
     LLHISLWSSV IFGMASVFSG VMRSSGTVMA PTAISILAIA AVEVPVAWVL SRHIGTDGIW       420
     AAYPAAFLAM FVMQGLYYAL VWRRRAQRFG IRRMV                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page