(data stored in ACNUC7421 zone)

EMBL: CP001069.PE393

CP001069.PE393       Location/Qualifiers
FT   CDS             complement(440739..442001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4170"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bja:blr5045 putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4170"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29269"
FT                   /db_xref="GOA:B2UI68"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI68"
FT                   /protein_id="ACD29269.1"
FT                   /translation="MSDPHDPAVDHLPPGFNRLADSNLAAQSAEQIALAAMPMVAVLTL
FT                   HADASTASWLQVALTLPFVLFAIPIGMLADRWPKRALMADAEAMRALALFVVAGLLAAG
FT                   RLNLAALGVLGFVAVCGTVVFSVAAPALVPSLVPAAMLARANGRIELARTVAFACGPAI
FT                   GGALIGWTGAMAAFVLAAALSTMASAMLAGVTAQEPVARRAAHPLRDIAEGARFVFQHP
FT                   LLRPVFITQFVFTMAFFMVSAIFVPYAAQRLNLTAQAIGLTLGMYGAGMVVGALLAARI
FT                   LARWRFGHVVATGPVCGLAGGVLLAATLWQPWPALAQAGFFLLGCGPILWVVSTTTLRQ
FT                   TVTPPALLARVSAVNVMSYGARPVGAAMAAWLAAHAGVGACLVVAVAGFALQLLCIVQS
FT                   PAVRLVRQPRADDASAGLEPA"
     MSDPHDPAVD HLPPGFNRLA DSNLAAQSAE QIALAAMPMV AVLTLHADAS TASWLQVALT        60
     LPFVLFAIPI GMLADRWPKR ALMADAEAMR ALALFVVAGL LAAGRLNLAA LGVLGFVAVC       120
     GTVVFSVAAP ALVPSLVPAA MLARANGRIE LARTVAFACG PAIGGALIGW TGAMAAFVLA       180
     AALSTMASAM LAGVTAQEPV ARRAAHPLRD IAEGARFVFQ HPLLRPVFIT QFVFTMAFFM       240
     VSAIFVPYAA QRLNLTAQAI GLTLGMYGAG MVVGALLAAR ILARWRFGHV VATGPVCGLA       300
     GGVLLAATLW QPWPALAQAG FFLLGCGPIL WVVSTTTLRQ TVTPPALLAR VSAVNVMSYG       360
     ARPVGAAMAA WLAAHAGVGA CLVVAVAGFA LQLLCIVQSP AVRLVRQPRA DDASAGLEPA       420
//

If you have problems or comments...

PBIL Back to PBIL home page