(data stored in ACNUC7421 zone)

EMBL: CP001069.PE397

CP001069.PE397       Location/Qualifiers
FT   CDS             445916..447484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4174"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: rso:RS03153 putative
FT                   methyl-accepting chemotaxis transducer transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4174"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29273"
FT                   /db_xref="GOA:B2UI72"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI72"
FT                   /protein_id="ACD29273.1"
FT                   /translation="MWKWMDTSIRTRLTFLVAVFAVMIAVVGFAGITTGRATNDDLRAV
FT                   YLEDAKGLDLLAKDTINLLWARIHLTNFDSVSSPEELKKLLADAHTMVNSANDAWAQFM
FT                   KLPIPEADRAQLQAADAARTKFVKTALEPAIAALERSDLTTYRELNTNLVPKLFVDYDT
FT                   ALGPLVGARFKYGQQRFDHSQSRYAMSIWISGGLLAAALVLSIVARGVLGRTVVRPLER
FT                   AIQVFERMASGDLATRMEGQTTAGRRDETARLMHAVSSMQTSLQQIIGQVRTGSDSIAS
FT                   ATKQIAAGNADLSQRTEQQASSLEETASSMEELTSIVKQNADNARQASTLAVSASDIAV
FT                   KGGEVVGRVVDTMAGINESSRKIADIIGVIEGIAFQTNILALNAAVEAARAGEQGRGFA
FT                   VVAGEVRSLAQRSATAAKEIKELIGDSVGRVQNGSTLVAEAGTVIDEVVVAVRRVTDIM
FT                   GEISAASEEQSSGIEQVNQAVTQMDQVTQQNAALVEQAAAAAESLEEQAEALRSAVAVF
FT                   RVEHA"
     MWKWMDTSIR TRLTFLVAVF AVMIAVVGFA GITTGRATND DLRAVYLEDA KGLDLLAKDT        60
     INLLWARIHL TNFDSVSSPE ELKKLLADAH TMVNSANDAW AQFMKLPIPE ADRAQLQAAD       120
     AARTKFVKTA LEPAIAALER SDLTTYRELN TNLVPKLFVD YDTALGPLVG ARFKYGQQRF       180
     DHSQSRYAMS IWISGGLLAA ALVLSIVARG VLGRTVVRPL ERAIQVFERM ASGDLATRME       240
     GQTTAGRRDE TARLMHAVSS MQTSLQQIIG QVRTGSDSIA SATKQIAAGN ADLSQRTEQQ       300
     ASSLEETASS MEELTSIVKQ NADNARQAST LAVSASDIAV KGGEVVGRVV DTMAGINESS       360
     RKIADIIGVI EGIAFQTNIL ALNAAVEAAR AGEQGRGFAV VAGEVRSLAQ RSATAAKEIK       420
     ELIGDSVGRV QNGSTLVAEA GTVIDEVVVA VRRVTDIMGE ISAASEEQSS GIEQVNQAVT       480
     QMDQVTQQNA ALVEQAAAAA ESLEEQAEAL RSAVAVFRVE HA                          522
//

If you have problems or comments...

PBIL Back to PBIL home page