(data stored in SCRATCH zone)

EMBL: CP001069.PE399

CP001069.PE399       Location/Qualifiers
FT   CDS             complement(449181..450086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4176"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG: rso:RS03149
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4176"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29275"
FT                   /db_xref="GOA:B2UI74"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI74"
FT                   /protein_id="ACD29275.1"
FT                   /translation="MLELQPLDIPLAIPLPWPMLDADGQLLVPKGDVIHSPEEIDLLCT
FT                   LHRPHRLADGTPAPAPAFANTQFPNTMFPDMGDDPDGERTIAMELLGLRPGGMLTVRLT
FT                   AGAGQTKGAARVMGYSPQRHLLITMPTDSGRTVMPVKDELVEVHAFSGEGIASFECTVM
FT                   AVCRIPFEYVVLSPPRRIKNRALRKSLRVRANVVGKMLVSGDPPRMIHISDISTTGASF
FT                   RSAHRLEVSGAPARLRFRVKTRDYHSELVAAALVRSEKPADLPNVYQYGVEFVELVAAQ
FT                   KMLLQCFIYEQLLWGGQRMV"
     MLELQPLDIP LAIPLPWPML DADGQLLVPK GDVIHSPEEI DLLCTLHRPH RLADGTPAPA        60
     PAFANTQFPN TMFPDMGDDP DGERTIAMEL LGLRPGGMLT VRLTAGAGQT KGAARVMGYS       120
     PQRHLLITMP TDSGRTVMPV KDELVEVHAF SGEGIASFEC TVMAVCRIPF EYVVLSPPRR       180
     IKNRALRKSL RVRANVVGKM LVSGDPPRMI HISDISTTGA SFRSAHRLEV SGAPARLRFR       240
     VKTRDYHSEL VAAALVRSEK PADLPNVYQY GVEFVELVAA QKMLLQCFIY EQLLWGGQRM       300
     V                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page