(data stored in SCRATCH zone)

EMBL: CP001069.PE40

CP001069.PE40        Location/Qualifiers
FT   CDS             45319..45636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3800"
FT                   /product="YCII-related"
FT                   /note="PFAM: YCII-related; KEGG: rso:RS01991 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3800"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28916"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH65"
FT                   /protein_id="ACD28916.1"
FT                   /translation="MLYLILFTYRAPLSEMERVLPAHRAHLDAHYASGHFLMSGPFFPR
FT                   EGGGILAQAGSRDEIDAIVMRDPFVLENLVEVRLIAWGPNRRSADVPQAWLPDATVAMP
FT                   T"
     MLYLILFTYR APLSEMERVL PAHRAHLDAH YASGHFLMSG PFFPREGGGI LAQAGSRDEI        60
     DAIVMRDPFV LENLVEVRLI AWGPNRRSAD VPQAWLPDAT VAMPT                       105
//

If you have problems or comments...

PBIL Back to PBIL home page