(data stored in SCRATCH zone)

EMBL: CP001069.PE400

CP001069.PE400       Location/Qualifiers
FT   CDS             450206..450718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4177"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: rme:Rmet_5967
FT                   GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4177"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29276"
FT                   /db_xref="GOA:B2UI75"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI75"
FT                   /protein_id="ACD29276.1"
FT                   /translation="MIEHNVGSKVDGVGTRMTSRRHFWAAVEQFARYVVIGGGATLAHY
FT                   VVLFGLVQVGVSPWRASVAGSVIGATLNYFISRQAVFNSTRGHIGAMVRFGLVAFLALG
FT                   CNATIMAAGLGIGLYYLIAQVFASSITAIFNFLVHRYWTFRDADAVGAPTEPQPTIVPA
FT                   RPTHNGP"
     MIEHNVGSKV DGVGTRMTSR RHFWAAVEQF ARYVVIGGGA TLAHYVVLFG LVQVGVSPWR        60
     ASVAGSVIGA TLNYFISRQA VFNSTRGHIG AMVRFGLVAF LALGCNATIM AAGLGIGLYY       120
     LIAQVFASSI TAIFNFLVHR YWTFRDADAV GAPTEPQPTI VPARPTHNGP                  170
//

If you have problems or comments...

PBIL Back to PBIL home page