(data stored in ACNUC7421 zone)

EMBL: CP001069.PE402

CP001069.PE402       Location/Qualifiers
FT   CDS             451870..453210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4179"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: rso:RS03147 hypothetical protein; TIGRFAM: PAS
FT                   sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4179"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29278"
FT                   /db_xref="GOA:B2UI77"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI77"
FT                   /protein_id="ACD29278.1"
FT                   /translation="MLEDDHLYKAAIEHSPIGIGLCAPEGRFLDVNRALCALTGHEAQA
FT                   LRTRDLFDLCHPDHTERTRHGIESLLTGQRDALSMETRLVRQDGTTVWVQTDVAVAHDH
FT                   GNQHLVVQMQDVTARRLALESLRASEQRLAYVLDGAGLGTFDWSTRARHVSFNRRTADM
FT                   LGYEPTDLSNDPDAWFAMVHPQDAALSARRIYRHMRGDADSFEIEQRMRARHGQWIWVA
FT                   ARGRVTERDARGMATRVSGTLLDVTKRRTALDQAHHLALHDPLTDLPNARLLRDRLFVA
FT                   IQAARRARGQVAVVFIDLDRFKPVNDEYGHAVGDLVLKATAMRLRSGLRASDTVARLGG
FT                   DEFVAVLTHCATRDDVTQTVERLIEQLQTPFRVEGHVLSMGVSAGVALYPTDGRDAQTL
FT                   IRNADAAMYEVKRAGGNGLGFHASLNYERLMGMRSRDRDLDGEADAR"
     MLEDDHLYKA AIEHSPIGIG LCAPEGRFLD VNRALCALTG HEAQALRTRD LFDLCHPDHT        60
     ERTRHGIESL LTGQRDALSM ETRLVRQDGT TVWVQTDVAV AHDHGNQHLV VQMQDVTARR       120
     LALESLRASE QRLAYVLDGA GLGTFDWSTR ARHVSFNRRT ADMLGYEPTD LSNDPDAWFA       180
     MVHPQDAALS ARRIYRHMRG DADSFEIEQR MRARHGQWIW VAARGRVTER DARGMATRVS       240
     GTLLDVTKRR TALDQAHHLA LHDPLTDLPN ARLLRDRLFV AIQAARRARG QVAVVFIDLD       300
     RFKPVNDEYG HAVGDLVLKA TAMRLRSGLR ASDTVARLGG DEFVAVLTHC ATRDDVTQTV       360
     ERLIEQLQTP FRVEGHVLSM GVSAGVALYP TDGRDAQTLI RNADAAMYEV KRAGGNGLGF       420
     HASLNYERLM GMRSRDRDLD GEADAR                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page