(data stored in ACNUC7421 zone)

EMBL: CP001069.PE405

CP001069.PE405       Location/Qualifiers
FT   CDS             complement(455661..458762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4182"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   rso:RS03143 probable drug efflux transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4182"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29281"
FT                   /db_xref="GOA:B2UI80"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI80"
FT                   /protein_id="ACD29281.1"
FT                   /translation="MNLSATFIARPVATALLTIGVALAGIAAFRLLPVSPLPQVDFPTI
FT                   SVNASLPGASPETMAATVATPLERSLGRIAGITEMTSSSSLGSSRITLQFDLSRDIDGA
FT                   ARDVQAAINASRSLLPSGLPSNPTYRKVNPADAPIMIVGLTSDTKSRGELYDAASTILA
FT                   QKLSQINGVGQVSIGGASLPAVRVELNPMALNKYGISMETVRTVITSTNANKPKGMMES
FT                   GDRVWTIYANDQAKKAVEYQSLIIAWRKGSPVRLADVAEVTDSVQDIRNYGSANGKPSV
FT                   LLIISRQPGANIIDTVDRINDVLPYLRNTIPAQINLDVMMDRTPTIRASLKDVERTLVL
FT                   SIALVIMVVFLFLRNVRATLIPSVAVPVSLIGTFGVMYLCGYSLDNLSLMALTVATGFV
FT                   VDDAIVVLENVSRHIENGMRPMQAALKGAREVGFTVVSMSFSLIAVFIPLLMMGGIVGR
FT                   LFREFAVTLSVAILVSLVVSLTTTPMMCARLLKPAAEEEHGWFHRKTEGFFTFLLDIYR
FT                   NSLAWALRHSWLTLLILLATVCLNVYLYIIVPKGFFPQQDTGRVIGFIQADQSISFQAM
FT                   RTKLTDFITIVRQDPAVENVVGFTGGSQRNTGQMFIQLKPLAERRMSADQIINRLRGKL
FT                   AGEPGASLFLQSVQDIRVGGRASNAQYQYTLQADDLNELRAWDPKIKQALTQVKSLTDV
FT                   NTDTQDKGLQTSLVIDRDKAKSLGINPSDIDNALNNAFGQRQVSTIYNPLNQYRVVMEA
FT                   APQYWQNPDGLRDIYIITSTGAQVPLSTFSHYEPTNTALAVNHQGQFAASTISFNLAPG
FT                   ASLSGATQDIQDAMNRIGVPSSVHGSFQGTAKAFQDSLSSQPVLILFALITIYIVLGLL
FT                   YESYVHPITILSTLPSAGVGALLALIITDTDFSIIALIGVILLIGIVKKNAIMMIDFAL
FT                   EAERSQGMSPADAIFHACVLRFRPILMTTMAALLGALPLALGHGDGAELRTPLGISIVG
FT                   GLLVSQILTLYTTPVVYLALDRLRLRRAGRSKDAPLPALDSQGS"
     MNLSATFIAR PVATALLTIG VALAGIAAFR LLPVSPLPQV DFPTISVNAS LPGASPETMA        60
     ATVATPLERS LGRIAGITEM TSSSSLGSSR ITLQFDLSRD IDGAARDVQA AINASRSLLP       120
     SGLPSNPTYR KVNPADAPIM IVGLTSDTKS RGELYDAAST ILAQKLSQIN GVGQVSIGGA       180
     SLPAVRVELN PMALNKYGIS METVRTVITS TNANKPKGMM ESGDRVWTIY ANDQAKKAVE       240
     YQSLIIAWRK GSPVRLADVA EVTDSVQDIR NYGSANGKPS VLLIISRQPG ANIIDTVDRI       300
     NDVLPYLRNT IPAQINLDVM MDRTPTIRAS LKDVERTLVL SIALVIMVVF LFLRNVRATL       360
     IPSVAVPVSL IGTFGVMYLC GYSLDNLSLM ALTVATGFVV DDAIVVLENV SRHIENGMRP       420
     MQAALKGARE VGFTVVSMSF SLIAVFIPLL MMGGIVGRLF REFAVTLSVA ILVSLVVSLT       480
     TTPMMCARLL KPAAEEEHGW FHRKTEGFFT FLLDIYRNSL AWALRHSWLT LLILLATVCL       540
     NVYLYIIVPK GFFPQQDTGR VIGFIQADQS ISFQAMRTKL TDFITIVRQD PAVENVVGFT       600
     GGSQRNTGQM FIQLKPLAER RMSADQIINR LRGKLAGEPG ASLFLQSVQD IRVGGRASNA       660
     QYQYTLQADD LNELRAWDPK IKQALTQVKS LTDVNTDTQD KGLQTSLVID RDKAKSLGIN       720
     PSDIDNALNN AFGQRQVSTI YNPLNQYRVV MEAAPQYWQN PDGLRDIYII TSTGAQVPLS       780
     TFSHYEPTNT ALAVNHQGQF AASTISFNLA PGASLSGATQ DIQDAMNRIG VPSSVHGSFQ       840
     GTAKAFQDSL SSQPVLILFA LITIYIVLGL LYESYVHPIT ILSTLPSAGV GALLALIITD       900
     TDFSIIALIG VILLIGIVKK NAIMMIDFAL EAERSQGMSP ADAIFHACVL RFRPILMTTM       960
     AALLGALPLA LGHGDGAELR TPLGISIVGG LLVSQILTLY TTPVVYLALD RLRLRRAGRS      1020
     KDAPLPALDS QGS                                                         1033
//

If you have problems or comments...

PBIL Back to PBIL home page