(data stored in ACNUC7421 zone)

EMBL: CP001069.PE406

CP001069.PE406       Location/Qualifiers
FT   CDS             complement(458759..461893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4183"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   rso:RS03142 probable drug efflux PUMP transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4183"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29282"
FT                   /db_xref="GOA:B2UI81"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI81"
FT                   /protein_id="ACD29282.1"
FT                   /translation="MNPSRIFILRPVATTLLMVAILLSGLVAYRMLPLSALPEVDYPTI
FT                   QVTTLYPGASPDVMTSSITAPLERQFGQMPGLKQMTSSSSGGASVITLQFDLSLSLDIA
FT                   EQEVQAAINAAGNLLPNDLPMPPIYSKVNPADAPILALAITSNTMPLPKLEDLVDTRIA
FT                   QKLSQLPGIGLVSISGGQRPAVRIQANTSALAALGLSIDDIRTAIGTANVNGAKGSFDG
FT                   PMRASTIDANDQLKSAAEYSKMIVAYKNGAPIRLTDVAQIVDGAENSKLAAWSNTTPAI
FT                   ILNVQRQPGANVIEVVNRAKALLPQLKETLPGNVEVSLLTDRTTTIRASVSDVQFELML
FT                   AVALVVMVIFLFLRNVPATVIPAVAVPLSLVGTFGVMYLAGFSINNLTLMALTIATGFV
FT                   VDDAIVMIENIARYIEEGDPPMEAALKGSKQIGFTIISLTFSLIAVLIPLLFMGDVVGR
FT                   LFREFAITLAVSILISAVVSLTLTPMMCARLLKHIPEAEQSRFYHAAGAFFDNVIARYG
FT                   RMLQWVLDRQKTTLLVAIGTLVLTGLLYVVVPKGFFPVQDTGVIQGISDASQSISFSAM
FT                   AERQQKLAEVVLKDPAVESLSSFIGVDGVNTTLNSGRMLINLKPKDERDADATEIIQRL
FT                   QPELAKVAGISLYMQPVQDLTIEDRVSRTQYQFTVEDPDPNNLSKWVPKLVERLQQTRE
FT                   LRDVASDLQDNGLRAYVQVDRDKAAVYGITMAAVDSVLYSAYGQRLISTIFTQSNQYRV
FT                   VLETDPKMQLGPQSLYDLHVASSSGQQIPLGAFATVVEQPGSLVVNHQGQFPAATISFN
FT                   LAPRASLGAAVDTINAVEEEIGLPASMQTSFQGAALAFRASLSNQLWLILAAIITMYIV
FT                   LGVLYESTIHPVTILSTLPSAGVGALLSLLVSGKDMGIIAIIGIILLIGIVKKNAIMMI
FT                   DFALEAEREQGMAPRDAIYQACLLRFRPILMTTMAALLGALPLMLGTGVGSELRQPLGI
FT                   TMVGGLLVSQVLTLFTTPVIYLAFDSLGGRLRDWRARRAARRHGAAGANQSGGQR"
     MNPSRIFILR PVATTLLMVA ILLSGLVAYR MLPLSALPEV DYPTIQVTTL YPGASPDVMT        60
     SSITAPLERQ FGQMPGLKQM TSSSSGGASV ITLQFDLSLS LDIAEQEVQA AINAAGNLLP       120
     NDLPMPPIYS KVNPADAPIL ALAITSNTMP LPKLEDLVDT RIAQKLSQLP GIGLVSISGG       180
     QRPAVRIQAN TSALAALGLS IDDIRTAIGT ANVNGAKGSF DGPMRASTID ANDQLKSAAE       240
     YSKMIVAYKN GAPIRLTDVA QIVDGAENSK LAAWSNTTPA IILNVQRQPG ANVIEVVNRA       300
     KALLPQLKET LPGNVEVSLL TDRTTTIRAS VSDVQFELML AVALVVMVIF LFLRNVPATV       360
     IPAVAVPLSL VGTFGVMYLA GFSINNLTLM ALTIATGFVV DDAIVMIENI ARYIEEGDPP       420
     MEAALKGSKQ IGFTIISLTF SLIAVLIPLL FMGDVVGRLF REFAITLAVS ILISAVVSLT       480
     LTPMMCARLL KHIPEAEQSR FYHAAGAFFD NVIARYGRML QWVLDRQKTT LLVAIGTLVL       540
     TGLLYVVVPK GFFPVQDTGV IQGISDASQS ISFSAMAERQ QKLAEVVLKD PAVESLSSFI       600
     GVDGVNTTLN SGRMLINLKP KDERDADATE IIQRLQPELA KVAGISLYMQ PVQDLTIEDR       660
     VSRTQYQFTV EDPDPNNLSK WVPKLVERLQ QTRELRDVAS DLQDNGLRAY VQVDRDKAAV       720
     YGITMAAVDS VLYSAYGQRL ISTIFTQSNQ YRVVLETDPK MQLGPQSLYD LHVASSSGQQ       780
     IPLGAFATVV EQPGSLVVNH QGQFPAATIS FNLAPRASLG AAVDTINAVE EEIGLPASMQ       840
     TSFQGAALAF RASLSNQLWL ILAAIITMYI VLGVLYESTI HPVTILSTLP SAGVGALLSL       900
     LVSGKDMGII AIIGIILLIG IVKKNAIMMI DFALEAEREQ GMAPRDAIYQ ACLLRFRPIL       960
     MTTMAALLGA LPLMLGTGVG SELRQPLGIT MVGGLLVSQV LTLFTTPVIY LAFDSLGGRL      1020
     RDWRARRAAR RHGAAGANQS GGQR                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page