(data stored in ACNUC7421 zone)

EMBL: CP001069.PE407

CP001069.PE407       Location/Qualifiers
FT   CDS             complement(461951..463339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4184"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   rso:RS03141 putative resistance transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4184"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29283"
FT                   /db_xref="GOA:B2UI82"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI82"
FT                   /protein_id="ACD29283.1"
FT                   /translation="MSDPKDQKPGQFDDAGRRTHAGKETPNEVSPTLLPPPREGGKRRR
FT                   WGIWVVITLLVLIGYAVYHAKYRDAGGPGGRGGAGGRGAAMAGKPMPVMVGTAIKGDIN
FT                   VVLSALGNVTPVNNVTVKTRVDGQLVRLAFTEGQTVKAGDLLAEVDPRTYQAQLAQAEG
FT                   QLARDQALLHNAKLDLQRYQTLLSQDSISKQQVDTQAALVRQYDGTVKLDQGNVDNARV
FT                   QLSYTRITAPVSGRVGLRQVDPGNIVHASDTNGIVVITQIDPITVIYSIPEDNLPKVMP
FT                   RLQSGDKLPVEAWDRGQTTQLARGVLMTVDNTIDNTTGTVKLRAQFPNQNAMLFPNQFV
FT                   NVRMRVDTLRDVVIVPGAAIQRGTQGTFVYVVGDNNKVALRLVKLGVTEGDRVSVAQGL
FT                   QPGERVVIDGADKLRDGSPVEVIQPGAAAASAPAAGQADQGGRHRRGQGGASAPAASAP
FT                   AAKP"
     MSDPKDQKPG QFDDAGRRTH AGKETPNEVS PTLLPPPREG GKRRRWGIWV VITLLVLIGY        60
     AVYHAKYRDA GGPGGRGGAG GRGAAMAGKP MPVMVGTAIK GDINVVLSAL GNVTPVNNVT       120
     VKTRVDGQLV RLAFTEGQTV KAGDLLAEVD PRTYQAQLAQ AEGQLARDQA LLHNAKLDLQ       180
     RYQTLLSQDS ISKQQVDTQA ALVRQYDGTV KLDQGNVDNA RVQLSYTRIT APVSGRVGLR       240
     QVDPGNIVHA SDTNGIVVIT QIDPITVIYS IPEDNLPKVM PRLQSGDKLP VEAWDRGQTT       300
     QLARGVLMTV DNTIDNTTGT VKLRAQFPNQ NAMLFPNQFV NVRMRVDTLR DVVIVPGAAI       360
     QRGTQGTFVY VVGDNNKVAL RLVKLGVTEG DRVSVAQGLQ PGERVVIDGA DKLRDGSPVE       420
     VIQPGAAAAS APAAGQADQG GRHRRGQGGA SAPAASAPAA KP                          462
//

If you have problems or comments...

PBIL Back to PBIL home page