(data stored in ACNUC7421 zone)

EMBL: CP001069.PE408

CP001069.PE408       Location/Qualifiers
FT   CDS             463593..464324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4185"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rso:RS03140 probable two
FT                   component response regulator transcription regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4185"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29284"
FT                   /db_xref="GOA:B2UI83"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI83"
FT                   /protein_id="ACD29284.1"
FT                   /translation="MSGTKILVVDDDVELRDLLREYLTQQGFAVSVLHDGDGLAARLER
FT                   ERPALVVLDLMMPKVDGLSALRDLRARNDDVPVILLTARSDEIDRIIGLEIGADDYLGK
FT                   PFSPRELLARINAVLRRRLTVPASAPEDRDSFSFGPFKLNFRMRTLFRGDSALSISDTE
FT                   FALLKLLIGHAMQVLTREHIVELMYGPGSGVSDRGIDVQIWRLRRVLEEDAQRPRYIQT
FT                   VRGRGYTFVPDEREEVNEVQG"
     MSGTKILVVD DDVELRDLLR EYLTQQGFAV SVLHDGDGLA ARLERERPAL VVLDLMMPKV        60
     DGLSALRDLR ARNDDVPVIL LTARSDEIDR IIGLEIGADD YLGKPFSPRE LLARINAVLR       120
     RRLTVPASAP EDRDSFSFGP FKLNFRMRTL FRGDSALSIS DTEFALLKLL IGHAMQVLTR       180
     EHIVELMYGP GSGVSDRGID VQIWRLRRVL EEDAQRPRYI QTVRGRGYTF VPDEREEVNE       240
     VQG                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page