(data stored in ACNUC7421 zone)

EMBL: CP001069.PE409

CP001069.PE409       Location/Qualifiers
FT   CDS             464308..465594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4186"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: rso:RS03139 probable two
FT                   component transmembrane sensor kinase transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4186"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29285"
FT                   /db_xref="GOA:B2UI84"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI84"
FT                   /protein_id="ACD29285.1"
FT                   /translation="MKFRARFDTLFGRLAVLIVVVLVLSHFSWLGVLRAERRERQFQAS
FT                   VDQMAFQLQAFQAAMDGHLHVKLPDLVTETDEPPSGDASSASDKSAELVRQLARRLPSD
FT                   TQLRLEAGPTPRVFVRFSQRNKWIAMPLVWVHAPPSISAVVPGVMVVLAIAIAFSLFAA
FT                   WQIQRPVRELADAAGALARRRYVAPLKERGPYELRQLTVQFNHMAADLSAADEERNTML
FT                   AGIAHDLKTPLSRLRLRAEMLADQKAGAGIERDVESMSAIVEQFLAYAQSGDSEAREVS
FT                   VDRHLRGLVQPFAEQGKHVALDLHAGDRFRLKPTHLERIVVNLLDNAFAYGAEPVNVRT
FT                   SADETGYTLTVEDHGAGIPVADFDRVMRPFVRLDPARGGNAHCGLGLAIVDRLVRHLGG
FT                   DLTVGPTATDAPSPGFRVTMRFPVSTAAA"
     MKFRARFDTL FGRLAVLIVV VLVLSHFSWL GVLRAERRER QFQASVDQMA FQLQAFQAAM        60
     DGHLHVKLPD LVTETDEPPS GDASSASDKS AELVRQLARR LPSDTQLRLE AGPTPRVFVR       120
     FSQRNKWIAM PLVWVHAPPS ISAVVPGVMV VLAIAIAFSL FAAWQIQRPV RELADAAGAL       180
     ARRRYVAPLK ERGPYELRQL TVQFNHMAAD LSAADEERNT MLAGIAHDLK TPLSRLRLRA       240
     EMLADQKAGA GIERDVESMS AIVEQFLAYA QSGDSEAREV SVDRHLRGLV QPFAEQGKHV       300
     ALDLHAGDRF RLKPTHLERI VVNLLDNAFA YGAEPVNVRT SADETGYTLT VEDHGAGIPV       360
     ADFDRVMRPF VRLDPARGGN AHCGLGLAIV DRLVRHLGGD LTVGPTATDA PSPGFRVTMR       420
     FPVSTAAA                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page