(data stored in SCRATCH zone)

EMBL: CP001069.PE410

CP001069.PE410       Location/Qualifiers
FT   CDS             465701..466138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4187"
FT                   /product="protein of unknown function DUF333"
FT                   /note="PFAM: protein of unknown function DUF333; KEGG:
FT                   rso:RS03138 probable proline rich transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4187"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29286"
FT                   /db_xref="InterPro:IPR005590"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI85"
FT                   /protein_id="ACD29286.1"
FT                   /translation="MNRAVCLVKDAGQARMTAAVATCVLAMGLAACSSPMPPWEPPRTI
FT                   IQPAPPPPRPAPAPPTPLPPSPAMQPAPAQPPAYAPPPAGDTEPPRATPGMANPASTYC
FT                   LQRGGQLEFSTRANGAEVGTCVSPGGDECEEWAFLRGSCTW"
     MNRAVCLVKD AGQARMTAAV ATCVLAMGLA ACSSPMPPWE PPRTIIQPAP PPPRPAPAPP        60
     TPLPPSPAMQ PAPAQPPAYA PPPAGDTEPP RATPGMANPA STYCLQRGGQ LEFSTRANGA       120
     EVGTCVSPGG DECEEWAFLR GSCTW                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page