(data stored in ACNUC7421 zone)

EMBL: CP001069.PE411

CP001069.PE411       Location/Qualifiers
FT   CDS             467180..467986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4189"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bxe:Bxe_C0489 putative transposase IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4189"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29287"
FT                   /db_xref="GOA:B2U8P5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:B2U8P5"
FT                   /protein_id="ACD29287.1"
FT                   /translation="MEKRRPYPSDVSDEEWSFAAPYLTLMNQDAPQRRYELRELFNALR
FT                   WLARAGAAWRMLPTNFPPWEAVYQQTQRWLRGGCFEAMVQDLRSVLRVAQGRQGQPSAV
FT                   ILDGRTLQSTCESGPRAGYDGYKRKRGSKVHMAVDTLGHLLAVHITPANEQERAQVQVL
FT                   AREVQLVTGQTVKLAFADQGYTGEEPAQAARDEGIELQVIKLPEAKKGFVLLPRRWVVE
FT                   RSFGWLNRFRRLARDYERLPETLAGLHFVVFAMLMLVHAAPVVQSA"
     MEKRRPYPSD VSDEEWSFAA PYLTLMNQDA PQRRYELREL FNALRWLARA GAAWRMLPTN        60
     FPPWEAVYQQ TQRWLRGGCF EAMVQDLRSV LRVAQGRQGQ PSAVILDGRT LQSTCESGPR       120
     AGYDGYKRKR GSKVHMAVDT LGHLLAVHIT PANEQERAQV QVLAREVQLV TGQTVKLAFA       180
     DQGYTGEEPA QAARDEGIEL QVIKLPEAKK GFVLLPRRWV VERSFGWLNR FRRLARDYER       240
     LPETLAGLHF VVFAMLMLVH AAPVVQSA                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page