(data stored in ACNUC7421 zone)

EMBL: CP001069.PE414

CP001069.PE414       Location/Qualifiers
FT   CDS             complement(470844..472196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4193"
FT                   /product="gluconate transporter"
FT                   /note="TIGRFAM: gluconate transporter; PFAM: Gluconate
FT                   transporter; Citrate transporter; KEGG: rso:RSp1189
FT                   probable high-affinity gluconate transporter (GNT-III
FT                   system) transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4193"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29290"
FT                   /db_xref="GOA:B2UI89"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI89"
FT                   /protein_id="ACD29290.1"
FT                   /translation="MVPMQGNSLLLTAALAVVALIYLIAVQKLNPFVTLIVVSLVLGVV
FT                   VGMPMGNIVKAFETGVGNTLGHIALVVGLGTMLGKMMAESGGAERIAKTLISAFGEKNA
FT                   HWAMMVVAFIIGLPVFFEVGFVLLIPIAFNVAKRTGTPILLVGLPMVAGLSVVHGLIPP
FT                   HPAALLAVTAYQADIGKTIMYALIVGLPTAILAGPLWAMLVSRYVKPDENNPLAAQFVE
FT                   ADQKRELPGFGVTLFTILLPVVLMLIGSWADLIVAPKTLANDILKLAGNSVMALLIAAI
FT                   VSFYTFGKARGFNRETILKFTNECLAPIATITLVVGAGGGFGQILRDSGVSKAIVAVAT
FT                   DAHLSPLLLGWVVAVLIRIATGSATVAMTTACGIVAPIAAASGAAVKPELMVLATGAGS
FT                   LILSHVNDGGFWLVKEYFNLTVPQTFKTWTVLETIISIVALLLTLALATVV"
     MVPMQGNSLL LTAALAVVAL IYLIAVQKLN PFVTLIVVSL VLGVVVGMPM GNIVKAFETG        60
     VGNTLGHIAL VVGLGTMLGK MMAESGGAER IAKTLISAFG EKNAHWAMMV VAFIIGLPVF       120
     FEVGFVLLIP IAFNVAKRTG TPILLVGLPM VAGLSVVHGL IPPHPAALLA VTAYQADIGK       180
     TIMYALIVGL PTAILAGPLW AMLVSRYVKP DENNPLAAQF VEADQKRELP GFGVTLFTIL       240
     LPVVLMLIGS WADLIVAPKT LANDILKLAG NSVMALLIAA IVSFYTFGKA RGFNRETILK       300
     FTNECLAPIA TITLVVGAGG GFGQILRDSG VSKAIVAVAT DAHLSPLLLG WVVAVLIRIA       360
     TGSATVAMTT ACGIVAPIAA ASGAAVKPEL MVLATGAGSL ILSHVNDGGF WLVKEYFNLT       420
     VPQTFKTWTV LETIISIVAL LLTLALATVV                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page