(data stored in ACNUC7421 zone)

EMBL: CP001069.PE415

CP001069.PE415       Location/Qualifiers
FT   CDS             complement(472277..472663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4194"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: rso:RS03132
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4194"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29291"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI90"
FT                   /protein_id="ACD29291.1"
FT                   /translation="MTITRIGVEGGTGTGGQHLPFARAAGADGWLFVSGQTPMVNGEVV
FT                   GNGIVEQSHQTIKNVLAILAEAGYGPEHVVRCGVWLDDPRDFQSFNKVFKEYFGANPPA
FT                   RACVVSSMVIDCKVEVDCVAYKKP"
     MTITRIGVEG GTGTGGQHLP FARAAGADGW LFVSGQTPMV NGEVVGNGIV EQSHQTIKNV        60
     LAILAEAGYG PEHVVRCGVW LDDPRDFQSF NKVFKEYFGA NPPARACVVS SMVIDCKVEV       120
     DCVAYKKP                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page