(data stored in ACNUC7421 zone)

EMBL: CP001069.PE417

CP001069.PE417       Location/Qualifiers
FT   CDS             complement(474191..475084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4196"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: rso:RS03130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4196"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29293"
FT                   /db_xref="GOA:B2UI92"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI92"
FT                   /protein_id="ACD29293.1"
FT                   /translation="MRDPKPDPMREPMDIVTRLSQRAAELRPAEQKVAQTVLSDIAEAA
FT                   AGSIQTLAERAGVSEASVTRFAKAMGCRDVRELKLKLAQAAAVGQRFLDGGADRPPSSA
FT                   DGILADISNVLEANRALVQPEAFRAAAVALVAARMIAVFGMGGGSTTMADEMRYRLARL
FT                   GRPVTTYHDSMLQRMVAATLSPDDVVVVFSVTGHVPEVIDSVTIAREYGARIVAITAIG
FT                   SPLAALADVLLPIQAMETDFIFKPSSSRYAMMMMIDLLATEVALQQADRSKELLRRIKY
FT                   VLDAHRGGGNRQPLGD"
     MRDPKPDPMR EPMDIVTRLS QRAAELRPAE QKVAQTVLSD IAEAAAGSIQ TLAERAGVSE        60
     ASVTRFAKAM GCRDVRELKL KLAQAAAVGQ RFLDGGADRP PSSADGILAD ISNVLEANRA       120
     LVQPEAFRAA AVALVAARMI AVFGMGGGST TMADEMRYRL ARLGRPVTTY HDSMLQRMVA       180
     ATLSPDDVVV VFSVTGHVPE VIDSVTIARE YGARIVAITA IGSPLAALAD VLLPIQAMET       240
     DFIFKPSSSR YAMMMMIDLL ATEVALQQAD RSKELLRRIK YVLDAHRGGG NRQPLGD          297
//

If you have problems or comments...

PBIL Back to PBIL home page