(data stored in ACNUC7421 zone)

EMBL: CP001069.PE419

CP001069.PE419       Location/Qualifiers
FT   CDS             476513..477439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4198"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: rso:RS05074
FT                   putative fructokinase-like protein (sugar kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4198"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29295"
FT                   /db_xref="GOA:B2UI94"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI94"
FT                   /protein_id="ACD29295.1"
FT                   /translation="MADILAYGEALIEFNQADSGSTSWNFGFGGDTSNFCIAAARQGAR
FT                   TGYISAVGADRFGQALRGLWQDEGVDHTYVHTDTQAPTGLYFVSHDARGHHFDYLRAGS
FT                   AASRFQTAQLPLQAIAAAKAFHLSGISLAISDTACDAGLAAMAHARAAGVLVSFDTNLR
FT                   LRLWPLARARAVMQEAMRTCDLCLPSWDDVTVLLDCHDHDGIVDTLLGWGVKLVALKMG
FT                   AEGCYVATPESRTLVPRHTVNAVDATGAGDCFGGAFVARIVAGDSPVEAARYANVAAAI
FT                   STTGYSAVAPIPRAEVVRAALGQVQAD"
     MADILAYGEA LIEFNQADSG STSWNFGFGG DTSNFCIAAA RQGARTGYIS AVGADRFGQA        60
     LRGLWQDEGV DHTYVHTDTQ APTGLYFVSH DARGHHFDYL RAGSAASRFQ TAQLPLQAIA       120
     AAKAFHLSGI SLAISDTACD AGLAAMAHAR AAGVLVSFDT NLRLRLWPLA RARAVMQEAM       180
     RTCDLCLPSW DDVTVLLDCH DHDGIVDTLL GWGVKLVALK MGAEGCYVAT PESRTLVPRH       240
     TVNAVDATGA GDCFGGAFVA RIVAGDSPVE AARYANVAAA ISTTGYSAVA PIPRAEVVRA       300
     ALGQVQAD                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page