(data stored in ACNUC7421 zone)

EMBL: CP001069.PE42

CP001069.PE42        Location/Qualifiers
FT   CDS             47353..49581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3802"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: reu:Reut_A2876 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3802"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28918"
FT                   /db_xref="GOA:B2UH67"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH67"
FT                   /protein_id="ACD28918.1"
FT                   /translation="MNRRTPVASALLALFATPPVALAQQAPSSPIAATTTLPEAVVRAT
FT                   APRDDYNAAKSSISKLPENLRDVPQSVTVVPKALTDAQGGSSLADALRNVPGITIGAAE
FT                   GGQIGNNINLNGFSARTDIYLDGFRDRGQYYRDLFALDSVEVLMGPSSMLFGRGSTGGV
FT                   INQVTKKPKLKAATEITGSVTTNGLVRATADVNTPTSDTSAFRIAAMAQNGKTSTRDEM
FT                   TAQDFGIAPSWRFGIGTPTEVTLSALLQHNRDMPDYGVPNLNGHPVNVSPKTYYGYTDD
FT                   RTTQDVASFSANIDHKFSPNLRLRNQTQFNYVQTDARETAPNAVGTVNSSGVFTALTNS
FT                   NLPLSALSVRLQSHDRRIRDYSLFNQTELTAKFDTGSVKHTLLVGTEFGHDGYDNQNYY
FT                   RNGSCNGTPLAQSSMTSGFVSCEPLVSPSYTTSPASTPSSLGNLQGGSANTVAAYFNDS
FT                   IEFTKQWKAVAGLRYDRYVASISNSLNSANTPASAKITALPYAQQSVNFVSTRLGGIWQ
FT                   PTDWQSYYVSYGTSFNPSLEQLVGTTGQQGLDPEKNKSYEAGGKWDLLNGDLSVSSALF
FT                   QITKDNARTQIDSTTYTSAGKIRVRGARLGATGHVTDKLQIFAGYTYLDAQIVNGIAAG
FT                   TQGMTPANTPKHSATVWTSYAFVPNWEVGAGAFYMSQRYANNTNTVQTGGFVRWDAMLA
FT                   YHQPKYDVRLNLFNVFNKTYYDALIPSDGGRAVPGTGRAAMLSVVYRM"
     MNRRTPVASA LLALFATPPV ALAQQAPSSP IAATTTLPEA VVRATAPRDD YNAAKSSISK        60
     LPENLRDVPQ SVTVVPKALT DAQGGSSLAD ALRNVPGITI GAAEGGQIGN NINLNGFSAR       120
     TDIYLDGFRD RGQYYRDLFA LDSVEVLMGP SSMLFGRGST GGVINQVTKK PKLKAATEIT       180
     GSVTTNGLVR ATADVNTPTS DTSAFRIAAM AQNGKTSTRD EMTAQDFGIA PSWRFGIGTP       240
     TEVTLSALLQ HNRDMPDYGV PNLNGHPVNV SPKTYYGYTD DRTTQDVASF SANIDHKFSP       300
     NLRLRNQTQF NYVQTDARET APNAVGTVNS SGVFTALTNS NLPLSALSVR LQSHDRRIRD       360
     YSLFNQTELT AKFDTGSVKH TLLVGTEFGH DGYDNQNYYR NGSCNGTPLA QSSMTSGFVS       420
     CEPLVSPSYT TSPASTPSSL GNLQGGSANT VAAYFNDSIE FTKQWKAVAG LRYDRYVASI       480
     SNSLNSANTP ASAKITALPY AQQSVNFVST RLGGIWQPTD WQSYYVSYGT SFNPSLEQLV       540
     GTTGQQGLDP EKNKSYEAGG KWDLLNGDLS VSSALFQITK DNARTQIDST TYTSAGKIRV       600
     RGARLGATGH VTDKLQIFAG YTYLDAQIVN GIAAGTQGMT PANTPKHSAT VWTSYAFVPN       660
     WEVGAGAFYM SQRYANNTNT VQTGGFVRWD AMLAYHQPKY DVRLNLFNVF NKTYYDALIP       720
     SDGGRAVPGT GRAAMLSVVY RM                                                742
//

If you have problems or comments...

PBIL Back to PBIL home page