(data stored in ACNUC7421 zone)

EMBL: CP001069.PE421

CP001069.PE421       Location/Qualifiers
FT   CDS             complement(480464..482500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4200"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: rso:RS05068 probable composite two-component
FT                   transcriptional regulatory (sensor histidine kinase and
FT                   response regulator hybrid) transcription regulator protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: response regulator
FT                   receiver; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold-4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4200"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29297"
FT                   /db_xref="GOA:B2UI96"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI96"
FT                   /protein_id="ACD29297.1"
FT                   /translation="MTSILPSSSRPSDARAADPARLPDPGPFSKSGFNDAPAIRPSAWL
FT                   VAMGAAAVGTIGRLLLESAMGIHLPFYLAFPVVTIAAWYGGFWPGMLAIVCYAGLFIAL
FT                   AALQSWPAAVPLTPIQMTVFGVGALLICALCEQLRRARAGAERRARAETQQRLSQQRLL
FT                   AALQASPISLYDVDNTMHFTWVHNPVFGLQPEQLLGRTVREVFGRRAASRLTEAGQRVI
FT                   ATGTPTRVEFAFRRRHTQRVVYDVVVMPLRDDTGEIIGLTNAVIDISERRQAEARRTQL
FT                   LEAESRAREEAERASRLKDDFLATVSHELRTPLNAVLGWAQLLNMRAYDEAMFKRGIEA
FT                   IERSARTQVHLIDDLLDMSAILSGKVPLEIGPVDLADVLERARETIEPMARQKNITIET
FT                   EFLPVPMLQGDAGRLKQVFWNLLANAVKFTPEGGHIRLSVHPAPEGVVATVRDTGIGIE
FT                   PTFLPHIFDRFQQADLSSTRRHGGLGLGLAIAKQLVELHHGRITAASSGADRGTTMAVS
FT                   LPLHAAQPGEQANRTPGLVAGTGVPTLDGIRVLAVDDNPESLGVIALMLERYGADVVTV
FT                   SSGAAALDALEHAVANAYPFDALVSDLAMPGMDGMQLVRAVRERGWTDLPAIAVTAFAD
FT                   PIRLKAAKEAGYQSVITKPIFPGELGHVLAANVHRKTGPETLV"
     MTSILPSSSR PSDARAADPA RLPDPGPFSK SGFNDAPAIR PSAWLVAMGA AAVGTIGRLL        60
     LESAMGIHLP FYLAFPVVTI AAWYGGFWPG MLAIVCYAGL FIALAALQSW PAAVPLTPIQ       120
     MTVFGVGALL ICALCEQLRR ARAGAERRAR AETQQRLSQQ RLLAALQASP ISLYDVDNTM       180
     HFTWVHNPVF GLQPEQLLGR TVREVFGRRA ASRLTEAGQR VIATGTPTRV EFAFRRRHTQ       240
     RVVYDVVVMP LRDDTGEIIG LTNAVIDISE RRQAEARRTQ LLEAESRARE EAERASRLKD       300
     DFLATVSHEL RTPLNAVLGW AQLLNMRAYD EAMFKRGIEA IERSARTQVH LIDDLLDMSA       360
     ILSGKVPLEI GPVDLADVLE RARETIEPMA RQKNITIETE FLPVPMLQGD AGRLKQVFWN       420
     LLANAVKFTP EGGHIRLSVH PAPEGVVATV RDTGIGIEPT FLPHIFDRFQ QADLSSTRRH       480
     GGLGLGLAIA KQLVELHHGR ITAASSGADR GTTMAVSLPL HAAQPGEQAN RTPGLVAGTG       540
     VPTLDGIRVL AVDDNPESLG VIALMLERYG ADVVTVSSGA AALDALEHAV ANAYPFDALV       600
     SDLAMPGMDG MQLVRAVRER GWTDLPAIAV TAFADPIRLK AAKEAGYQSV ITKPIFPGEL       660
     GHVLAANVHR KTGPETLV                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page