(data stored in SCRATCH zone)

EMBL: CP001069.PE423

CP001069.PE423       Location/Qualifiers
FT   CDS             484103..484459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B4511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4202"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29299"
FT                   /db_xref="InterPro:IPR021513"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI98"
FT                   /protein_id="ACD29299.1"
FT                   /translation="MATHNARSKPAPPRSTAKPKNHRWSRHVMETSDALDIEPDIFKLR
FT                   SPARIAASLKASAEHSRRRKGTAFQSAMSMLTFYINRAAHNLSGGRRRILERAKDALRA
FT                   EFGRRAQSTAKARH"
     MATHNARSKP APPRSTAKPK NHRWSRHVME TSDALDIEPD IFKLRSPARI AASLKASAEH        60
     SRRRKGTAFQ SAMSMLTFYI NRAAHNLSGG RRRILERAKD ALRAEFGRRA QSTAKARH         118
//

If you have problems or comments...

PBIL Back to PBIL home page