(data stored in ACNUC7421 zone)

EMBL: CP001069.PE424

CP001069.PE424       Location/Qualifiers
FT   CDS             complement(484478..484756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4203"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS05066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4203"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29300"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI99"
FT                   /protein_id="ACD29300.1"
FT                   /translation="MRHPEQQALASYPPLSAVPPSPATQETARLIAETIPFNLERGGRT
FT                   IEATYSTRNGIVTVKYRGKTLSTYSPQSDNADYKAVARQLLSVMLTI"
     MRHPEQQALA SYPPLSAVPP SPATQETARL IAETIPFNLE RGGRTIEATY STRNGIVTVK        60
     YRGKTLSTYS PQSDNADYKA VARQLLSVML TI                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page