(data stored in ACNUC7421 zone)

EMBL: CP001069.PE425

CP001069.PE425       Location/Qualifiers
FT   CDS             485110..485358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4204"
FT                   /product="protein of unknown function DUF1458"
FT                   /note="PFAM: protein of unknown function DUF1458; KEGG:
FT                   rso:RS05065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4204"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29301"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIA0"
FT                   /protein_id="ACD29301.1"
FT                   /translation="MGSHTYKLIELVGSSPESSDAAVRNAIARASETLNHLDWFEVLET
FT                   RGHLVDGKIAHWQVTLKVGMRLETLESEKPAGKKKGK"
     MGSHTYKLIE LVGSSPESSD AAVRNAIARA SETLNHLDWF EVLETRGHLV DGKIAHWQVT        60
     LKVGMRLETL ESEKPAGKKK GK                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page