(data stored in SCRATCH zone)

EMBL: CP001069.PE428

CP001069.PE428       Location/Qualifiers
FT   CDS             489376..490956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4207"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; Integral membrane protein
FT                   TerC; KEGG: rso:RS05062 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4207"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29304"
FT                   /db_xref="GOA:B2UIA3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIA3"
FT                   /protein_id="ACD29304.1"
FT                   /translation="MTWLADPSVWIGLFTLVVLEIVLGIDNLVFIAILVNKLPPALRDR
FT                   ARVIGLGLALLMRMVLLAAMSWLIGLTRPLLTLGPVDLSGRSIILLLGGFFLLFKATSE
FT                   LHERLDGQPQDESHGSGHGKFWNVIVQVVILDAVFSIDSVITAVGMVNDLPVMMAAVVV
FT                   AMGAMLFASRPLTEFVNAHRTVVVLCLSFLLMIGFSLVAEGLGFHIPKGYLYAAIGFSI
FT                   LIEFFNQMAQRNTVRYERRRPLRERTADAVLSLLGDRRGAPAESESHEAVSHAAGQSVP
FT                   ETVFRPEERSMVSGVLDLAERSVRSIMTPRHDISWVDLDADVAVTRKLLLAVPHNQFPV
FT                   CRGGLDDLLGVARAKDLMGDLDTRGSIDVDRSVKPALKVSDNIGILRLMDQLKRARGRM
FT                   LVVTDPLDVVQGVVTPIDVLEAIAGEFPDEDERLGVVEVSDGCWEVAGEADLRQLEDVL
FT                   HVEWLLDEGGGATSLGGYLFNQWDRLPEVGDTLVRHDLRFQILEAGSRRIVRVRIERME
FT                   DVTAPEAEA"
     MTWLADPSVW IGLFTLVVLE IVLGIDNLVF IAILVNKLPP ALRDRARVIG LGLALLMRMV        60
     LLAAMSWLIG LTRPLLTLGP VDLSGRSIIL LLGGFFLLFK ATSELHERLD GQPQDESHGS       120
     GHGKFWNVIV QVVILDAVFS IDSVITAVGM VNDLPVMMAA VVVAMGAMLF ASRPLTEFVN       180
     AHRTVVVLCL SFLLMIGFSL VAEGLGFHIP KGYLYAAIGF SILIEFFNQM AQRNTVRYER       240
     RRPLRERTAD AVLSLLGDRR GAPAESESHE AVSHAAGQSV PETVFRPEER SMVSGVLDLA       300
     ERSVRSIMTP RHDISWVDLD ADVAVTRKLL LAVPHNQFPV CRGGLDDLLG VARAKDLMGD       360
     LDTRGSIDVD RSVKPALKVS DNIGILRLMD QLKRARGRML VVTDPLDVVQ GVVTPIDVLE       420
     AIAGEFPDED ERLGVVEVSD GCWEVAGEAD LRQLEDVLHV EWLLDEGGGA TSLGGYLFNQ       480
     WDRLPEVGDT LVRHDLRFQI LEAGSRRIVR VRIERMEDVT APEAEA                      526
//

If you have problems or comments...

PBIL Back to PBIL home page