(data stored in SCRATCH zone)

EMBL: CP001069.PE434

CP001069.PE434       Location/Qualifiers
FT   CDS             complement(495942..496382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4213"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: rso:RS05426
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4213"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29310"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIA9"
FT                   /protein_id="ACD29310.1"
FT                   /translation="MFTHILLPTDGSEQCRKAIDGALELARATGCRLTAYTCIEEFPNM
FT                   AYSAGVGECPHAYYMETVQGYAKDCIERIAERAREEGVQFDSDVSQFAEPYLGILDAAE
FT                   RHACDVIFMASHGHRSLMGRLLIGNETRKVLTYAHVPVVVYR"
     MFTHILLPTD GSEQCRKAID GALELARATG CRLTAYTCIE EFPNMAYSAG VGECPHAYYM        60
     ETVQGYAKDC IERIAERARE EGVQFDSDVS QFAEPYLGIL DAAERHACDV IFMASHGHRS       120
     LMGRLLIGNE TRKVLTYAHV PVVVYR                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page